Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   LDM87_RS00735 Genome accession   NZ_AP024964
Coordinates   155455..155580 (+) Length   41 a.a.
NCBI ID   WP_120902658.1    Uniprot ID   -
Organism   Helicobacter pylori strain #6     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 150455..160580
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LDM87_RS00710 (OHP006_01430) - 150517..152739 (+) 2223 WP_223893182.1 ATP-dependent Clp protease ATP-binding subunit -
  LDM87_RS00715 (OHP006_01440) panD 152729..153079 (+) 351 WP_073470207.1 aspartate 1-decarboxylase -
  LDM87_RS00720 (OHP006_01450) - 153090..153383 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  LDM87_RS00725 (OHP006_01460) - 153383..154378 (+) 996 WP_223894148.1 PDZ domain-containing protein -
  LDM87_RS00730 (OHP006_01470) comB6 154384..155439 (+) 1056 WP_223894150.1 P-type conjugative transfer protein TrbL Machinery gene
  LDM87_RS00735 comB7 155455..155580 (+) 126 WP_120902658.1 comB7 lipoprotein Machinery gene
  LDM87_RS00740 (OHP006_01480) comB8 155577..156314 (+) 738 WP_075708163.1 virB8 family protein Machinery gene
  LDM87_RS00745 (OHP006_01490) comB9 156314..157279 (+) 966 WP_223893185.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  LDM87_RS00750 (OHP006_01500) comB10 157272..158408 (+) 1137 WP_212888858.1 DNA type IV secretion system protein ComB10 Machinery gene
  LDM87_RS00755 (OHP006_01510) - 158478..159890 (+) 1413 WP_223893187.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4812.85 Da        Isoelectric Point: 9.3278

>NTDB_id=89727 LDM87_RS00735 WP_120902658.1 155455..155580(+) (comB7) [Helicobacter pylori strain #6]
MRIFFVIMGLILFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=89727 LDM87_RS00735 WP_120902658.1 155455..155580(+) (comB7) [Helicobacter pylori strain #6]
ATGAGAATTTTTTTTGTCATTATGGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854

Multiple sequence alignment