Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   LDM86_RS06890 Genome accession   NZ_AP024962
Coordinates   1429913..1430038 (-) Length   41 a.a.
NCBI ID   WP_075668089.1    Uniprot ID   -
Organism   Helicobacter pylori strain #3     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1424913..1435038
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LDM86_RS06870 (OHP003_13700) - 1425597..1427009 (-) 1413 WP_223889099.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  LDM86_RS06875 (OHP003_13710) comB10 1427079..1428215 (-) 1137 WP_223889100.1 DNA type IV secretion system protein ComB10 Machinery gene
  LDM86_RS06880 (OHP003_13720) comB9 1428208..1429173 (-) 966 WP_223889101.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  LDM86_RS06885 (OHP003_13730) comB8 1429173..1429916 (-) 744 WP_212894963.1 virB8 family protein Machinery gene
  LDM86_RS06890 comB7 1429913..1430038 (-) 126 WP_075668089.1 comB7 lipoprotein Machinery gene
  LDM86_RS06895 (OHP003_13740) comB6 1430054..1431109 (-) 1056 WP_223889102.1 P-type conjugative transfer protein TrbL Machinery gene
  LDM86_RS06900 (OHP003_13750) - 1431117..1432112 (-) 996 WP_223889612.1 PDZ domain-containing protein -
  LDM86_RS06905 (OHP003_13760) - 1432112..1432405 (-) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  LDM86_RS06910 (OHP003_13770) panD 1432416..1432766 (-) 351 WP_140515993.1 aspartate 1-decarboxylase -
  LDM86_RS06915 (OHP003_13780) - 1432756..1434978 (-) 2223 WP_223889103.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4738.72 Da        Isoelectric Point: 9.3278

>NTDB_id=89700 LDM86_RS06890 WP_075668089.1 1429913..1430038(-) (comB7) [Helicobacter pylori strain #3]
MRIFSVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=89700 LDM86_RS06890 WP_075668089.1 1429913..1430038(-) (comB7) [Helicobacter pylori strain #3]
ATGAGAATTTTTTCTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCCTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854

Multiple sequence alignment