Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   R5O67_RS12975 Genome accession   NZ_CP137217
Coordinates   2700471..2701010 (+) Length   179 a.a.
NCBI ID   WP_142836750.1    Uniprot ID   -
Organism   Proteus mirabilis strain PM33     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2666980..2710952 2700471..2701010 within 0


Gene organization within MGE regions


Location: 2666980..2710952
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R5O67_RS12735 (R5O67_12735) - 2666980..2667186 (+) 207 WP_104836668.1 DNA polymerase III subunit theta -
  R5O67_RS22175 - 2667410..2668261 (+) 852 WP_367303130.1 acyltransferase family protein -
  R5O67_RS12740 (R5O67_12740) - 2668321..2670213 (-) 1893 WP_254361031.1 phage head-binding domain-containing protein -
  R5O67_RS12745 (R5O67_12745) - 2670327..2672357 (-) 2031 WP_317850615.1 lytic transglycosylase domain-containing protein -
  R5O67_RS12750 (R5O67_12750) - 2672357..2673802 (-) 1446 WP_317850616.1 phage DNA ejection protein -
  R5O67_RS12755 (R5O67_12755) - 2673812..2674471 (-) 660 WP_102086755.1 DNA transfer protein -
  R5O67_RS12760 (R5O67_12760) - 2674465..2674926 (-) 462 WP_317850617.1 DUF2824 family protein -
  R5O67_RS12765 (R5O67_12765) - 2674926..2675648 (-) 723 WP_252731176.1 hemolysin XhlA family protein -
  R5O67_RS12770 (R5O67_12770) - 2675645..2677426 (-) 1782 WP_317850618.1 packaged DNA stabilization protein -
  R5O67_RS12775 (R5O67_12775) - 2677398..2677880 (-) 483 WP_273799505.1 packaged DNA stabilization gp4 family protein -
  R5O67_RS12780 (R5O67_12780) - 2677861..2678052 (-) 192 WP_124743767.1 hypothetical protein -
  R5O67_RS12785 (R5O67_12785) - 2678106..2679377 (-) 1272 WP_124743768.1 P22 phage major capsid protein family protein -
  R5O67_RS12790 (R5O67_12790) - 2679392..2680291 (-) 900 WP_284311233.1 phage capsid protein -
  R5O67_RS12795 (R5O67_12795) - 2680302..2682503 (-) 2202 WP_317850619.1 portal protein -
  R5O67_RS12800 (R5O67_12800) - 2682506..2683918 (-) 1413 WP_317850620.1 PBSX family phage terminase large subunit -
  R5O67_RS12805 (R5O67_12805) - 2683920..2684303 (-) 384 WP_201285252.1 ubiquitin carboxyl-hydrolase -
  R5O67_RS12810 (R5O67_12810) - 2684398..2684625 (-) 228 WP_284311242.1 DUF2560 family protein -
  R5O67_RS12815 (R5O67_12815) - 2684949..2685401 (-) 453 WP_277273310.1 lysis protein -
  R5O67_RS12820 (R5O67_12820) - 2685398..2685790 (-) 393 WP_064497292.1 M15 family metallopeptidase -
  R5O67_RS12825 (R5O67_12825) - 2685783..2686100 (-) 318 WP_064497293.1 phage holin, lambda family -
  R5O67_RS12830 (R5O67_12830) - 2687017..2687655 (-) 639 WP_317850621.1 hypothetical protein -
  R5O67_RS12835 (R5O67_12835) - 2687652..2687870 (-) 219 WP_223231902.1 hypothetical protein -
  R5O67_RS12840 (R5O67_12840) - 2687857..2688222 (-) 366 WP_161728930.1 RusA family crossover junction endodeoxyribonuclease -
  R5O67_RS12845 (R5O67_12845) - 2688219..2688509 (-) 291 WP_063108505.1 DUF1364 domain-containing protein -
  R5O67_RS12850 (R5O67_12850) - 2688602..2689060 (-) 459 WP_121909377.1 hypothetical protein -
  R5O67_RS12855 (R5O67_12855) - 2689063..2689185 (-) 123 WP_259466354.1 hypothetical protein -
  R5O67_RS12860 (R5O67_12860) - 2689182..2689406 (-) 225 WP_149127668.1 DUF3310 domain-containing protein -
  R5O67_RS12865 (R5O67_12865) - 2689403..2689846 (-) 444 WP_149127669.1 YbcN family protein -
  R5O67_RS12870 (R5O67_12870) - 2690182..2690475 (-) 294 WP_063073731.1 hypothetical protein -
  R5O67_RS12875 (R5O67_12875) - 2690462..2690683 (-) 222 WP_036935835.1 hypothetical protein -
  R5O67_RS12880 (R5O67_12880) - 2690699..2690866 (-) 168 WP_152964332.1 hypothetical protein -
  R5O67_RS12885 (R5O67_12885) - 2690885..2692252 (-) 1368 WP_121909389.1 replicative DNA helicase -
  R5O67_RS12890 (R5O67_12890) - 2692256..2693092 (-) 837 WP_110229454.1 replication protein -
  R5O67_RS12895 (R5O67_12895) - 2693089..2693772 (-) 684 WP_175246700.1 phage antirepressor KilAC domain-containing protein -
  R5O67_RS12900 (R5O67_12900) - 2693794..2694126 (-) 333 WP_063073726.1 CII family transcriptional regulator -
  R5O67_RS12905 (R5O67_12905) - 2694261..2694488 (-) 228 WP_049216808.1 helix-turn-helix domain-containing protein -
  R5O67_RS12910 (R5O67_12910) - 2694567..2695244 (+) 678 WP_196538690.1 LexA family protein -
  R5O67_RS12915 (R5O67_12915) - 2695270..2695617 (+) 348 WP_317850622.1 Rap1a/Tai family immunity protein -
  R5O67_RS12920 (R5O67_12920) - 2696016..2696288 (+) 273 WP_317850623.1 hypothetical protein -
  R5O67_RS12925 (R5O67_12925) - 2696299..2696535 (+) 237 WP_049220845.1 hypothetical protein -
  R5O67_RS12930 (R5O67_12930) - 2696507..2696788 (-) 282 WP_071233777.1 hypothetical protein -
  R5O67_RS12935 (R5O67_12935) - 2696957..2697229 (+) 273 WP_071233776.1 hypothetical protein -
  R5O67_RS12940 (R5O67_12940) - 2697273..2697497 (+) 225 WP_162778485.1 hypothetical protein -
  R5O67_RS12945 (R5O67_12945) - 2697569..2697724 (+) 156 WP_183129929.1 hypothetical protein -
  R5O67_RS12950 (R5O67_12950) - 2697732..2697986 (+) 255 WP_063073719.1 hypothetical protein -
  R5O67_RS12955 (R5O67_12955) - 2697983..2698204 (+) 222 WP_049199148.1 hypothetical protein -
  R5O67_RS12960 (R5O67_12960) - 2698201..2699127 (+) 927 WP_063073718.1 recombinase RecT -
  R5O67_RS12965 (R5O67_12965) - 2699167..2699787 (+) 621 WP_049206325.1 hypothetical protein -
  R5O67_RS12970 (R5O67_12970) - 2699780..2700481 (+) 702 WP_096043072.1 lambda exonuclease family protein -
  R5O67_RS12975 (R5O67_12975) ssb 2700471..2701010 (+) 540 WP_142836750.1 single-stranded DNA-binding protein Machinery gene
  R5O67_RS12980 (R5O67_12980) - 2701026..2701187 (+) 162 WP_153274246.1 hypothetical protein -
  R5O67_RS12985 (R5O67_12985) - 2701229..2701447 (+) 219 WP_142836744.1 hypothetical protein -
  R5O67_RS12990 (R5O67_12990) - 2701483..2701803 (+) 321 WP_261261989.1 hypothetical protein -
  R5O67_RS12995 (R5O67_12995) - 2701803..2702090 (+) 288 WP_060558090.1 cyclic-phosphate processing receiver domain-containing protein -
  R5O67_RS13000 (R5O67_13000) - 2702090..2702443 (+) 354 WP_063073715.1 hypothetical protein -
  R5O67_RS13005 (R5O67_13005) - 2702453..2702821 (+) 369 WP_063073714.1 hypothetical protein -
  R5O67_RS13010 (R5O67_13010) - 2702969..2703136 (+) 168 WP_156868475.1 hypothetical protein -
  R5O67_RS13015 (R5O67_13015) - 2703129..2703485 (+) 357 WP_096043071.1 phage protein NinX family protein -
  R5O67_RS13020 (R5O67_13020) - 2703472..2704074 (+) 603 WP_096043070.1 MT-A70 family methyltransferase -
  R5O67_RS13030 (R5O67_13030) - 2704287..2704478 (+) 192 WP_036905342.1 helix-turn-helix transcriptional regulator -
  R5O67_RS13035 (R5O67_13035) - 2704456..2705631 (-) 1176 WP_049256663.1 tyrosine-type recombinase/integrase -
  R5O67_RS13045 (R5O67_13045) - 2706130..2706933 (+) 804 WP_004250658.1 sulfite exporter TauE/SafE family protein -
  R5O67_RS13050 (R5O67_13050) phsA 2707715..2709685 (+) 1971 Protein_2532 thiosulfate reductase PhsA -
  R5O67_RS13055 (R5O67_13055) - 2709739..2710952 (+) 1214 WP_369719335.1 IS3 family transposase -

Sequence

Protein


Download         Length: 179 a.a.        Molecular weight: 19733.11 Da        Isoelectric Point: 7.2415

>NTDB_id=896951 R5O67_RS12975 WP_142836750.1 2700471..2701010(+) (ssb) [Proteus mirabilis strain PM33]
MASKGVNKCILIGHLGQDPEIRYMPSGGAVANLTLATSESWRDKQTGEMKDRVEWHRVCIFGKLAEIAGEYLRKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNIGGTMQMLGGNGGNQAGSQKPQQNQGWGQPQQPQAPKQASSNQTPQSEPPQDWDD
PIPFAPIGLPYPRHAIYVI

Nucleotide


Download         Length: 540 bp        

>NTDB_id=896951 R5O67_RS12975 WP_142836750.1 2700471..2701010(+) (ssb) [Proteus mirabilis strain PM33]
ATGGCAAGTAAAGGCGTGAATAAATGTATTCTCATTGGTCACTTGGGGCAGGATCCAGAAATCCGTTATATGCCATCAGG
TGGCGCAGTCGCTAATCTCACACTAGCCACATCGGAATCGTGGCGTGATAAGCAGACTGGTGAAATGAAGGATCGGGTTG
AGTGGCATCGAGTGTGCATCTTCGGAAAATTAGCCGAAATTGCAGGTGAATATCTGAGAAAAGGAAGTCAGGTATATATC
GAGGGCTCACTGCAAACCAGAAAATGGCAAGACCAAAGCGGTCAAGACCGATACACAACGGAAGTAGTGGTCAATATTGG
TGGAACAATGCAGATGCTAGGCGGTAACGGTGGTAATCAGGCAGGAAGCCAGAAGCCACAGCAAAACCAAGGATGGGGTC
AGCCTCAGCAACCGCAAGCGCCAAAACAAGCATCGAGTAATCAAACACCACAAAGTGAGCCACCTCAAGATTGGGATGAT
CCTATACCTTTCGCCCCTATCGGACTCCCCTACCCACGACACGCTATTTATGTGATTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

66.667

98.883

0.659
  ssb Glaesserella parasuis strain SC1401

50.829

100

0.514
  ssb Neisseria meningitidis MC58

43.182

98.324

0.425
  ssb Neisseria gonorrhoeae MS11

42.614

98.324

0.419