Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R4701_RS02575 Genome accession   NZ_CP137114
Coordinates   516503..516652 (-) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 15P3054     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 511503..521652
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R4701_RS02540 ccrZ 511801..512595 (-) 795 WP_000363002.1 cell cycle regulator CcrZ -
  R4701_RS02545 - 512757..513368 (-) 612 WP_317805976.1 type II CAAX endopeptidase family protein -
  R4701_RS02550 blpZ 513398..513646 (-) 249 WP_000276506.1 immunity protein BlpZ -
  R4701_RS02555 - 513688..514377 (-) 690 WP_000760515.1 CPBP family intramembrane glutamic endopeptidase -
  R4701_RS02560 - 514429..514812 (-) 384 WP_000877381.1 hypothetical protein -
  R4701_RS02565 - 515441..515799 (-) 359 Protein_509 immunity protein -
  R4701_RS02570 - 516280..516399 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  R4701_RS02575 cipB 516503..516652 (-) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  R4701_RS02580 blpK 516896..517144 (-) 249 WP_000379965.1 bacteriocin-like peptide BlpK -
  R4701_RS02585 blpJ 517213..517482 (-) 270 WP_001093250.1 bacteriocin-like peptide BlpJ -
  R4701_RS02590 blpI 517949..518146 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  R4701_RS02595 comA/nlmT 518435..519022 (+) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  R4701_RS02600 comA/nlmT 518967..519773 (+) 807 WP_317805977.1 ABC transporter transmembrane domain-containing protein Regulator
  R4701_RS02605 comA/nlmT 519810..520592 (+) 783 WP_317805978.1 ATP-binding cassette domain-containing protein Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=896155 R4701_RS02575 WP_001809846.1 516503..516652(-) (cipB) [Streptococcus pneumoniae strain 15P3054]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=896155 R4701_RS02575 WP_001809846.1 516503..516652(-) (cipB) [Streptococcus pneumoniae strain 15P3054]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531