Detailed information
Bioinformatically predicted
Overview
| Name | comW | Type | Regulator |
| Locus tag | R4707_RS05915 | Genome accession | NZ_CP137113 |
| Coordinates | 1111078..1111314 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939545.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain ZGX | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1102011..1148918 | 1111078..1111314 | within | 0 |
| IS/Tn | 1110555..1110761 | 1111078..1111314 | flank | 317 |
Gene organization within MGE regions
Location: 1102011..1148918
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R4707_RS05870 | ftsH | 1102011..1103969 (+) | 1959 | WP_000744540.1 | ATP-dependent zinc metalloprotease FtsH | - |
| R4707_RS05875 | comX/comX2 | 1104091..1104570 (+) | 480 | WP_000588864.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| R4707_RS05910 | - | 1109999..1110812 (-) | 814 | Protein_1112 | transposase | - |
| R4707_RS05915 | comW | 1111078..1111314 (+) | 237 | WP_000939545.1 | sigma(X)-activator ComW | Regulator |
| R4707_RS05920 | - | 1111545..1112831 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| R4707_RS05925 | tadA | 1113032..1113499 (+) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| R4707_RS05935 | - | 1113708..1114844 (-) | 1137 | WP_257617667.1 | site-specific integrase | - |
| R4707_RS05940 | - | 1114905..1115975 (-) | 1071 | WP_000401841.1 | type I restriction endonuclease | - |
| R4707_RS05945 | - | 1115992..1116372 (-) | 381 | WP_000170931.1 | ImmA/IrrE family metallo-endopeptidase | - |
| R4707_RS05950 | - | 1116385..1116648 (-) | 264 | WP_000285962.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| R4707_RS05955 | - | 1116648..1116881 (-) | 234 | WP_000156419.1 | hypothetical protein | - |
| R4707_RS05960 | - | 1116881..1117249 (-) | 369 | WP_000464160.1 | helix-turn-helix domain-containing protein | - |
| R4707_RS05965 | - | 1117546..1117677 (+) | 132 | WP_000253628.1 | hypothetical protein | - |
| R4707_RS05970 | - | 1117820..1118011 (+) | 192 | WP_050103969.1 | DNA-binding protein | - |
| R4707_RS05975 | - | 1118034..1118237 (+) | 204 | WP_001247549.1 | hypothetical protein | - |
| R4707_RS05980 | - | 1118392..1118559 (-) | 168 | WP_000024181.1 | YjzC family protein | - |
| R4707_RS05985 | - | 1118564..1118944 (+) | 381 | Protein_1126 | autolysin | - |
| R4707_RS05990 | - | 1119228..1119671 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| R4707_RS05995 | - | 1119673..1120188 (+) | 516 | WP_000691236.1 | histidine phosphatase family protein | - |
| R4707_RS06000 | radA | 1120202..1121563 (+) | 1362 | WP_081543142.1 | DNA repair protein RadA | Machinery gene |
| R4707_RS06005 | - | 1121636..1122133 (+) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| R4707_RS06010 | - | 1122158..1122973 (+) | 816 | WP_000749768.1 | PrsW family intramembrane metalloprotease | - |
| R4707_RS06015 | - | 1123118..1124086 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| R4707_RS06020 | - | 1124220..1124501 (-) | 282 | Protein_1133 | ISL3 family transposase | - |
| R4707_RS06025 | - | 1124628..1125535 (-) | 908 | Protein_1134 | Rpn family recombination-promoting nuclease/putative transposase | - |
| R4707_RS06030 | polA | 1125791..1128424 (+) | 2634 | WP_012677111.1 | DNA polymerase I | - |
| R4707_RS06035 | - | 1128509..1128946 (+) | 438 | WP_000076483.1 | CoA-binding protein | - |
| R4707_RS06040 | - | 1128987..1129460 (+) | 474 | WP_277776445.1 | hypothetical protein | - |
| R4707_RS06045 | - | 1129489..1130499 (-) | 1011 | WP_050201288.1 | YeiH family protein | - |
| R4707_RS06050 | - | 1130648..1131817 (+) | 1170 | WP_000366345.1 | pyridoxal phosphate-dependent aminotransferase | - |
| R4707_RS06055 | recO | 1131814..1132584 (+) | 771 | WP_000616162.1 | DNA repair protein RecO | - |
| R4707_RS06060 | plsX | 1132581..1133573 (+) | 993 | WP_000717458.1 | phosphate acyltransferase PlsX | - |
| R4707_RS06065 | - | 1133579..1133812 (+) | 234 | WP_000136447.1 | acyl carrier protein | - |
| R4707_RS06070 | - | 1133849..1134149 (+) | 301 | Protein_1143 | transposase family protein | - |
| R4707_RS06075 | blpU | 1134352..1134582 (+) | 231 | Protein_1144 | bacteriocin-like peptide BlpU | - |
| R4707_RS06080 | - | 1134585..1134710 (+) | 126 | WP_000346297.1 | PncF family bacteriocin immunity protein | - |
| R4707_RS06085 | comA | 1135297..1137450 (+) | 2154 | WP_081543028.1 | peptide cleavage/export ABC transporter ComA | Regulator |
| R4707_RS06090 | comB | 1137463..1138812 (+) | 1350 | WP_000801617.1 | competence pheromone export protein ComB | Regulator |
| R4707_RS06095 | purC | 1138982..1139689 (+) | 708 | WP_180377196.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| R4707_RS06100 | - | 1139691..1139834 (+) | 144 | WP_050167432.1 | hypothetical protein | - |
| R4707_RS06105 | - | 1139891..1143616 (+) | 3726 | WP_000361167.1 | phosphoribosylformylglycinamidine synthase | - |
| R4707_RS06110 | purF | 1143710..1145152 (+) | 1443 | WP_000220632.1 | amidophosphoribosyltransferase | - |
| R4707_RS06115 | purM | 1145189..1146211 (+) | 1023 | WP_000182575.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| R4707_RS06120 | purN | 1146208..1146753 (+) | 546 | WP_000717506.1 | phosphoribosylglycinamide formyltransferase | - |
| R4707_RS06125 | - | 1146837..1147346 (+) | 510 | WP_000894005.1 | VanZ family protein | - |
| R4707_RS06130 | purH | 1147371..1148918 (+) | 1548 | WP_000167072.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9658.13 Da Isoelectric Point: 6.7051
>NTDB_id=896122 R4707_RS05915 WP_000939545.1 1111078..1111314(+) (comW) [Streptococcus pneumoniae strain ZGX]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=896122 R4707_RS05915 WP_000939545.1 1111078..1111314(+) (comW) [Streptococcus pneumoniae strain ZGX]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAAGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAAGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comW | Streptococcus mitis SK321 |
75.641 |
100 |
0.756 |
| comW | Streptococcus mitis NCTC 12261 |
75.325 |
98.718 |
0.744 |