Detailed information
Bioinformatically predicted
Overview
| Name | comW | Type | Regulator |
| Locus tag | R4702_RS05320 | Genome accession | NZ_CP137106 |
| Coordinates | 1046541..1046777 (-) | Length | 78 a.a. |
| NCBI ID | WP_000939544.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 16P4028 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 993833..1057752 | 1046541..1046777 | within | 0 |
| IScluster/Tn | 1047095..1048154 | 1046541..1046777 | flank | 318 |
Gene organization within MGE regions
Location: 993833..1057752
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R4702_RS05000 | recO | 993833..994603 (-) | 771 | WP_317810427.1 | DNA repair protein RecO | - |
| R4702_RS05005 | - | 994600..995769 (-) | 1170 | WP_000366345.1 | pyridoxal phosphate-dependent aminotransferase | - |
| R4702_RS05010 | - | 995918..996928 (+) | 1011 | WP_000009157.1 | YeiH family protein | - |
| R4702_RS05015 | - | 996960..997397 (-) | 438 | WP_000076500.1 | CoA-binding protein | - |
| R4702_RS05020 | polA | 997482..1000115 (-) | 2634 | WP_317810431.1 | DNA polymerase I | - |
| R4702_RS05025 | - | 1000371..1001278 (+) | 908 | Protein_1004 | Rpn family recombination-promoting nuclease/putative transposase | - |
| R4702_RS05030 | - | 1001405..1001686 (+) | 282 | Protein_1005 | ISL3 family transposase | - |
| R4702_RS05035 | - | 1001820..1002788 (-) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| R4702_RS05040 | - | 1002933..1003748 (-) | 816 | WP_000749768.1 | PrsW family intramembrane metalloprotease | - |
| R4702_RS05045 | - | 1003775..1004272 (-) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| R4702_RS05050 | radA | 1004345..1005706 (-) | 1362 | WP_074017595.1 | DNA repair protein RadA | Machinery gene |
| R4702_RS05055 | - | 1005720..1006225 (-) | 506 | Protein_1010 | histidine phosphatase family protein | - |
| R4702_RS05060 | - | 1006227..1006670 (-) | 444 | WP_208706169.1 | dUTP diphosphatase | - |
| R4702_RS05065 | - | 1006975..1007124 (+) | 150 | WP_001030863.1 | hypothetical protein | - |
| R4702_RS05070 | - | 1007266..1007445 (+) | 180 | WP_001209433.1 | hypothetical protein | - |
| R4702_RS05075 | lytA | 1007665..1008621 (-) | 957 | WP_317810436.1 | N-acetylmuramoyl-L-alanine amidase LytA | - |
| R4702_RS05080 | - | 1008621..1008956 (-) | 336 | WP_001186204.1 | phage holin | - |
| R4702_RS05085 | - | 1008960..1009259 (-) | 300 | WP_001811580.1 | hypothetical protein | - |
| R4702_RS05090 | - | 1009269..1009619 (-) | 351 | WP_050247393.1 | hypothetical protein | - |
| R4702_RS05095 | - | 1009622..1009825 (-) | 204 | WP_088790641.1 | hypothetical protein | - |
| R4702_RS05100 | - | 1009806..1009922 (-) | 117 | WP_050394646.1 | hypothetical protein | - |
| R4702_RS05105 | - | 1009919..1018132 (-) | 8214 | WP_317810448.1 | phage tail spike protein | - |
| R4702_RS05110 | - | 1018133..1018855 (-) | 723 | WP_050308527.1 | hypothetical protein | - |
| R4702_RS05115 | - | 1018852..1021938 (-) | 3087 | WP_317810451.1 | phage tail tape measure protein | - |
| R4702_RS05120 | - | 1022216..1022635 (-) | 420 | WP_001227145.1 | hypothetical protein | - |
| R4702_RS05125 | - | 1022647..1023225 (-) | 579 | WP_000191278.1 | major tail protein | - |
| R4702_RS05130 | - | 1023237..1023560 (-) | 324 | WP_050889289.1 | hypothetical protein | - |
| R4702_RS05135 | - | 1023557..1023904 (-) | 348 | WP_000063884.1 | HK97 gp10 family phage protein | - |
| R4702_RS05140 | - | 1023901..1024200 (-) | 300 | WP_317810454.1 | phage head closure protein | - |
| R4702_RS05145 | - | 1024187..1024468 (-) | 282 | WP_000371962.1 | phage head-tail connector protein | - |
| R4702_RS05150 | - | 1024471..1024761 (-) | 291 | WP_000120767.1 | hypothetical protein | - |
| R4702_RS05155 | - | 1024773..1025939 (-) | 1167 | WP_050079567.1 | phage major capsid protein | - |
| R4702_RS05160 | - | 1025936..1026511 (-) | 576 | WP_033630931.1 | HK97 family phage prohead protease | - |
| R4702_RS05165 | - | 1026495..1027697 (-) | 1203 | WP_317810457.1 | phage portal protein | - |
| R4702_RS05170 | - | 1027715..1027933 (-) | 219 | WP_001002923.1 | hypothetical protein | - |
| R4702_RS05175 | - | 1027941..1029671 (-) | 1731 | WP_050202983.1 | terminase large subunit | - |
| R4702_RS05180 | - | 1029664..1030056 (-) | 393 | WP_001118282.1 | P27 family phage terminase small subunit | - |
| R4702_RS05185 | - | 1030195..1030515 (-) | 321 | WP_000282422.1 | HNH endonuclease | - |
| R4702_RS05190 | - | 1030635..1030826 (-) | 192 | WP_000238198.1 | hypothetical protein | - |
| R4702_RS05195 | - | 1030990..1031532 (-) | 543 | WP_000397549.1 | site-specific integrase | - |
| R4702_RS05200 | - | 1031722..1032123 (-) | 402 | WP_000736391.1 | transcriptional activator | - |
| R4702_RS05205 | - | 1032327..1032539 (-) | 213 | WP_001286809.1 | crAss001_48 related protein | - |
| R4702_RS05210 | - | 1032556..1033293 (-) | 738 | WP_069285235.1 | hypothetical protein | - |
| R4702_RS05215 | - | 1033295..1033729 (-) | 435 | WP_069285234.1 | hypothetical protein | - |
| R4702_RS05220 | - | 1033783..1033986 (-) | 204 | WP_000161126.1 | hypothetical protein | - |
| R4702_RS05225 | - | 1033973..1034766 (-) | 794 | Protein_1044 | DNA methyltransferase | - |
| R4702_RS05230 | - | 1034780..1035058 (-) | 279 | WP_001082461.1 | hypothetical protein | - |
| R4702_RS05235 | - | 1035060..1035755 (-) | 696 | WP_069285232.1 | site-specific DNA-methyltransferase | - |
| R4702_RS05240 | - | 1035755..1035952 (-) | 198 | WP_069285082.1 | hypothetical protein | - |
| R4702_RS05245 | - | 1035949..1036221 (-) | 273 | WP_000454230.1 | hypothetical protein | - |
| R4702_RS05250 | - | 1036541..1036708 (-) | 168 | WP_000152772.1 | hypothetical protein | - |
| R4702_RS05255 | - | 1036698..1037552 (-) | 855 | WP_317810475.1 | ATP-binding protein | - |
| R4702_RS05260 | - | 1037562..1038398 (-) | 837 | WP_317810478.1 | DnaD domain protein | - |
| R4702_RS05265 | - | 1038425..1038652 (-) | 228 | WP_015973623.1 | helix-turn-helix transcriptional regulator | - |
| R4702_RS05270 | - | 1038726..1038917 (+) | 192 | WP_050123367.1 | hypothetical protein | - |
| R4702_RS05275 | - | 1039139..1039792 (+) | 654 | WP_000136570.1 | hypothetical protein | - |
| R4702_RS05280 | - | 1040069..1040206 (-) | 138 | WP_000969963.1 | hypothetical protein | - |
| R4702_RS05285 | - | 1040279..1040554 (-) | 276 | WP_050220598.1 | hypothetical protein | - |
| R4702_RS05290 | - | 1040728..1041543 (+) | 816 | WP_050123759.1 | S24 family peptidase | - |
| R4702_RS05295 | - | 1041565..1042635 (+) | 1071 | WP_000420652.1 | hypothetical protein | - |
| R4702_RS05300 | - | 1043005..1044147 (+) | 1143 | WP_050123757.1 | site-specific integrase | - |
| R4702_RS05310 | tadA | 1044356..1044823 (-) | 468 | WP_000291875.1 | tRNA adenosine(34) deaminase TadA | - |
| R4702_RS05315 | - | 1045024..1046310 (-) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| R4702_RS05320 | comW | 1046541..1046777 (-) | 237 | WP_000939544.1 | sigma(X)-activator ComW | Regulator |
| R4702_RS05325 | - | 1047044..1048154 (+) | 1111 | Protein_1063 | transposase | - |
| R4702_RS05330 | - | 1048189..1048398 (-) | 210 | Protein_1064 | transposase | - |
| R4702_RS05365 | - | 1054212..1055165 (+) | 954 | WP_001155321.1 | IS30-like element ISSpn8 family transposase | - |
| R4702_RS05370 | comX/comX2 | 1055193..1055672 (-) | 480 | WP_000588897.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| R4702_RS05375 | ftsH | 1055794..1057752 (-) | 1959 | WP_000744557.1 | ATP-dependent zinc metalloprotease FtsH | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9667.10 Da Isoelectric Point: 6.4701
>NTDB_id=895548 R4702_RS05320 WP_000939544.1 1046541..1046777(-) (comW) [Streptococcus pneumoniae strain 16P4028]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCHRDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCHRDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=895548 R4702_RS05320 WP_000939544.1 1046541..1046777(-) (comW) [Streptococcus pneumoniae strain 16P4028]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCATAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCATAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae D39 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae R6 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae TIGR4 |
97.436 |
100 |
0.974 |
| comW | Streptococcus mitis SK321 |
78.205 |
100 |
0.782 |
| comW | Streptococcus mitis NCTC 12261 |
77.922 |
98.718 |
0.769 |