Detailed information NTG0894827

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: AAYR26_RS12045
• Genome accession: NZ_CP154901
• Coordinates: 2276240..2276677 (+)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain FUA2146
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2271240..2281677

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AAYR26_RS12010 (AAYR26_12020)	-	2271770..2272015 (-)	246	WP_003183483.1	DUF2626 domain-containing protein	-
AAYR26_RS12015 (AAYR26_12025)	-	2272224..2272601 (+)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
AAYR26_RS12025 (AAYR26_12035)	-	2272843..2273682 (+)	840	WP_003183480.1	STAS domain-containing protein	-
AAYR26_RS12030 (AAYR26_12040)	comGA	2273839..2274903 (+)	1065	WP_003183477.1	competence type IV pilus ATPase ComGA	Machinery gene
AAYR26_RS12035 (AAYR26_12045)	comGB	2274893..2275927 (+)	1035	WP_011198115.1	competence type IV pilus assembly protein ComGB	Machinery gene
AAYR26_RS12040 (AAYR26_12050)	comGC	2275941..2276234 (+)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
AAYR26_RS12045 (AAYR26_12055)	comGD	2276240..2276677 (+)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
AAYR26_RS12050 (AAYR26_12060)	comGE	2276661..2277008 (+)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
AAYR26_RS12055 (AAYR26_12065)	comGF	2277034..2277405 (+)	372	WP_003183461.1	competence type IV pilus minor pilin ComGF	Machinery gene
AAYR26_RS12060 (AAYR26_12070)	comGG	2277418..2277783 (+)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
AAYR26_RS12065 (AAYR26_12075)	-	2277872..2278054 (+)	183	WP_003183456.1	YqzE family protein	-
AAYR26_RS12070 (AAYR26_12080)	-	2278078..2278365 (-)	288	WP_223307118.1	YqzG/YhdC family protein	-
AAYR26_RS12075 (AAYR26_12085)	tapA	2278675..2279403 (+)	729	WP_003183451.1	amyloid fiber anchoring/assembly protein TapA	-
AAYR26_RS12080 (AAYR26_12090)	-	2279400..2279984 (+)	585	WP_003183449.1	signal peptidase I	-
AAYR26_RS12085 (AAYR26_12095)	-	2280058..2280852 (+)	795	WP_003183447.1	TasA family protein	-
AAYR26_RS12090 (AAYR26_12100)	sinR	2280957..2281292 (-)	336	WP_006637528.1	helix-turn-helix domain-containing protein	Regulator
AAYR26_RS12095 (AAYR26_12105)	sinI	2281326..2281502 (-)	177	WP_003183444.1	anti-repressor SinI family protein	Regulator

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=894827 AAYR26_RS12045 WP_009327905.1 2276240..2276677(+) (comGD) [Bacillus licheniformis strain FUA2146]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=894827 AAYR26_RS12045 WP_009327905.1 2276240..2276677(+) (comGD) [Bacillus licheniformis strain FUA2146]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393