Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   AAYR26_RS12055 Genome accession   NZ_CP154901
Coordinates   2277034..2277405 (+) Length   123 a.a.
NCBI ID   WP_003183461.1    Uniprot ID   -
Organism   Bacillus licheniformis strain FUA2146     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2272034..2282405
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAYR26_RS12015 (AAYR26_12025) - 2272224..2272601 (+) 378 WP_003183482.1 Spx/MgsR family RNA polymerase-binding regulatory protein -
  AAYR26_RS12025 (AAYR26_12035) - 2272843..2273682 (+) 840 WP_003183480.1 STAS domain-containing protein -
  AAYR26_RS12030 (AAYR26_12040) comGA 2273839..2274903 (+) 1065 WP_003183477.1 competence type IV pilus ATPase ComGA Machinery gene
  AAYR26_RS12035 (AAYR26_12045) comGB 2274893..2275927 (+) 1035 WP_011198115.1 competence type IV pilus assembly protein ComGB Machinery gene
  AAYR26_RS12040 (AAYR26_12050) comGC 2275941..2276234 (+) 294 WP_003183466.1 competence type IV pilus major pilin ComGC Machinery gene
  AAYR26_RS12045 (AAYR26_12055) comGD 2276240..2276677 (+) 438 WP_009327905.1 competence type IV pilus minor pilin ComGD Machinery gene
  AAYR26_RS12050 (AAYR26_12060) comGE 2276661..2277008 (+) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -
  AAYR26_RS12055 (AAYR26_12065) comGF 2277034..2277405 (+) 372 WP_003183461.1 competence type IV pilus minor pilin ComGF Machinery gene
  AAYR26_RS12060 (AAYR26_12070) comGG 2277418..2277783 (+) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  AAYR26_RS12065 (AAYR26_12075) - 2277872..2278054 (+) 183 WP_003183456.1 YqzE family protein -
  AAYR26_RS12070 (AAYR26_12080) - 2278078..2278365 (-) 288 WP_223307118.1 YqzG/YhdC family protein -
  AAYR26_RS12075 (AAYR26_12085) tapA 2278675..2279403 (+) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  AAYR26_RS12080 (AAYR26_12090) - 2279400..2279984 (+) 585 WP_003183449.1 signal peptidase I -
  AAYR26_RS12085 (AAYR26_12095) - 2280058..2280852 (+) 795 WP_003183447.1 TasA family protein -
  AAYR26_RS12090 (AAYR26_12100) sinR 2280957..2281292 (-) 336 WP_006637528.1 helix-turn-helix domain-containing protein Regulator
  AAYR26_RS12095 (AAYR26_12105) sinI 2281326..2281502 (-) 177 WP_003183444.1 anti-repressor SinI family protein Regulator

Sequence

Protein


Download         Length: 123 a.a.        Molecular weight: 14179.31 Da        Isoelectric Point: 10.3094

>NTDB_id=894828 AAYR26_RS12055 WP_003183461.1 2277034..2277405(+) (comGF) [Bacillus licheniformis strain FUA2146]
MFVAGTMASIFHLFLSPERNGSDIHPREWTITAEQILKESRNSIDIRSAGDHQSLAMTNRQGDTVRYEQYQTVIRKRVNG
KGHVPLLQHVKKMRFMIENHLLILEATSLSGKSYRTSIPLYHM

Nucleotide


Download         Length: 372 bp        

>NTDB_id=894828 AAYR26_RS12055 WP_003183461.1 2277034..2277405(+) (comGF) [Bacillus licheniformis strain FUA2146]
ATGTTCGTTGCAGGTACGATGGCCTCGATATTTCATCTGTTTTTATCCCCGGAAAGAAACGGTTCGGATATTCACCCCCG
TGAATGGACGATTACTGCCGAGCAAATATTGAAGGAGTCTAGGAATTCGATTGACATAAGAAGTGCCGGTGATCATCAGT
CACTAGCGATGACAAACCGCCAAGGTGACACCGTTCGCTATGAGCAATATCAGACAGTTATTCGAAAAAGGGTCAATGGA
AAAGGTCATGTGCCTCTATTACAGCATGTCAAAAAAATGAGGTTTATGATTGAAAATCACCTGCTGATCCTTGAAGCGAC
AAGTCTAAGCGGCAAATCATACCGCACGTCTATTCCGCTCTATCATATGTAA

Domains

Predicted by InterProScan.

Putative Competence protein ComGF (ComGF)

(19-114)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

38.843

98.374

0.382