Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | R3J30_RS03340 | Genome accession | NZ_CP136980 |
| Coordinates | 747073..747519 (-) | Length | 148 a.a. |
| NCBI ID | WP_021358633.1 | Uniprot ID | - |
| Organism | Xylella fastidiosa subsp. multiplex strain CFBP8417 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 740545..763794 | 747073..747519 | within | 0 |
Gene organization within MGE regions
Location: 740545..763794
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R3J30_RS03305 (R3J30_03305) | - | 740545..741351 (-) | 807 | WP_027700779.1 | ABC transporter ATP-binding protein | - |
| R3J30_RS03310 (R3J30_03310) | - | 741335..742474 (-) | 1140 | WP_076613203.1 | ABC transporter permease | - |
| R3J30_RS03315 (R3J30_03315) | - | 742584..743846 (+) | 1263 | WP_004083970.1 | threonine/serine exporter ThrE family protein | - |
| R3J30_RS03320 (R3J30_03320) | - | 744487..744693 (+) | 207 | WP_071869858.1 | hypothetical protein | - |
| R3J30_RS03325 (R3J30_03325) | - | 744763..744966 (+) | 204 | WP_071869871.1 | hypothetical protein | - |
| R3J30_RS03330 (R3J30_03330) | xerC | 745607..746779 (-) | 1173 | WP_004083967.1 | tyrosine recombinase XerC | - |
| R3J30_RS03335 (R3J30_03335) | - | 746779..747051 (-) | 273 | WP_004083966.1 | hypothetical protein | - |
| R3J30_RS03340 (R3J30_03340) | ssb | 747073..747519 (-) | 447 | WP_021358633.1 | single-stranded DNA-binding protein | Machinery gene |
| R3J30_RS03345 (R3J30_03345) | - | 747503..747973 (-) | 471 | WP_076613218.1 | DUF5131 family protein | - |
| R3J30_RS03350 (R3J30_03350) | - | 747966..748196 (-) | 231 | WP_021358635.1 | hypothetical protein | - |
| R3J30_RS03355 (R3J30_03355) | - | 748196..748729 (-) | 534 | WP_004083962.1 | hypothetical protein | - |
| R3J30_RS03360 (R3J30_03360) | - | 748726..749319 (-) | 594 | WP_004083960.1 | DapH/DapD/GlmU-related protein | - |
| R3J30_RS03365 (R3J30_03365) | - | 749412..749945 (-) | 534 | WP_004083959.1 | pilin | - |
| R3J30_RS03370 (R3J30_03370) | - | 750078..750344 (-) | 267 | WP_004084112.1 | hypothetical protein | - |
| R3J30_RS03375 (R3J30_03375) | - | 750341..750619 (-) | 279 | WP_004083957.1 | hypothetical protein | - |
| R3J30_RS03380 (R3J30_03380) | - | 750616..750837 (-) | 222 | WP_021358638.1 | hypothetical protein | - |
| R3J30_RS03385 (R3J30_03385) | - | 750834..751292 (-) | 459 | WP_004084109.1 | hypothetical protein | - |
| R3J30_RS03390 (R3J30_03390) | - | 751289..751753 (-) | 465 | WP_021358639.1 | DUF1566 domain-containing protein | - |
| R3J30_RS03395 (R3J30_03395) | - | 751750..752247 (-) | 498 | WP_021358640.1 | hypothetical protein | - |
| R3J30_RS03400 (R3J30_03400) | - | 752237..752860 (+) | 624 | WP_004083954.1 | hypothetical protein | - |
| R3J30_RS03405 (R3J30_03405) | - | 752962..753363 (-) | 402 | WP_004084104.1 | hypothetical protein | - |
| R3J30_RS03410 (R3J30_03410) | - | 753362..753850 (+) | 489 | WP_238836475.1 | CHC2 zinc finger domain-containing protein | - |
| R3J30_RS03415 (R3J30_03415) | - | 753786..754430 (+) | 645 | WP_228762222.1 | terminase gpA endonuclease subunit | - |
| R3J30_RS03420 (R3J30_03420) | - | 754507..754743 (+) | 237 | WP_012337727.1 | hypothetical protein | - |
| R3J30_RS03425 (R3J30_03425) | - | 754740..755255 (+) | 516 | WP_004083947.1 | phage portal protein | - |
| R3J30_RS03430 (R3J30_03430) | - | 755372..755662 (+) | 291 | WP_076613257.1 | hypothetical protein | - |
| R3J30_RS03435 (R3J30_03435) | - | 755789..756217 (+) | 429 | WP_004083945.1 | hypothetical protein | - |
| R3J30_RS03440 (R3J30_03440) | - | 756214..756450 (+) | 237 | WP_004083943.1 | hypothetical protein | - |
| R3J30_RS03445 (R3J30_03445) | - | 756440..759265 (+) | 2826 | WP_004083942.1 | phage tail protein | - |
| R3J30_RS03450 (R3J30_03450) | - | 759258..759770 (+) | 513 | WP_004083934.1 | hypothetical protein | - |
| R3J30_RS03455 (R3J30_03455) | - | 759774..760193 (+) | 420 | WP_004083636.1 | hypothetical protein | - |
| R3J30_RS03460 (R3J30_03460) | - | 760269..760964 (+) | 696 | WP_004083931.1 | hypothetical protein | - |
| R3J30_RS03465 (R3J30_03465) | - | 761024..761152 (-) | 129 | WP_256704593.1 | hypothetical protein | - |
| R3J30_RS03470 (R3J30_03470) | - | 761200..761307 (+) | 108 | Protein_664 | DNA adenine methylase | - |
| R3J30_RS03475 (R3J30_03475) | - | 761359..761985 (+) | 627 | WP_038230952.1 | IS607 family transposase | - |
| R3J30_RS03480 (R3J30_03480) | - | 761979..763175 (+) | 1197 | WP_004083925.1 | RNA-guided endonuclease TnpB family protein | - |
| R3J30_RS03485 (R3J30_03485) | - | 763228..763794 (-) | 567 | WP_004085755.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16536.38 Da Isoelectric Point: 6.4871
>NTDB_id=893996 R3J30_RS03340 WP_021358633.1 747073..747519(-) (ssb) [Xylella fastidiosa subsp. multiplex strain CFBP8417]
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGQDGQERYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGQDGQERYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
Nucleotide
Download Length: 447 bp
>NTDB_id=893996 R3J30_RS03340 WP_021358633.1 747073..747519(-) (ssb) [Xylella fastidiosa subsp. multiplex strain CFBP8417]
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTTGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCCAGGACGGTCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTTGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCCAGGACGGTCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
41.477 |
100 |
0.493 |
| ssb | Neisseria meningitidis MC58 |
38.728 |
100 |
0.453 |
| ssb | Neisseria gonorrhoeae MS11 |
38.728 |
100 |
0.453 |
| ssb | Glaesserella parasuis strain SC1401 |
41.304 |
93.243 |
0.385 |