Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | R3J36_RS06175 | Genome accession | NZ_CP136973 |
| Coordinates | 1368901..1369347 (+) | Length | 148 a.a. |
| NCBI ID | WP_021358633.1 | Uniprot ID | - |
| Organism | Xylella fastidiosa subsp. multiplex strain CFBP8068 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1351441..1395368 | 1368901..1369347 | within | 0 |
Gene organization within MGE regions
Location: 1351441..1395368
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R3J36_RS06020 (R3J36_06005) | - | 1351441..1351758 (+) | 318 | WP_004084245.1 | BrnA antitoxin family protein | - |
| R3J36_RS06025 (R3J36_06010) | - | 1352164..1352406 (+) | 243 | WP_020851762.1 | hypothetical protein | - |
| R3J36_RS06030 (R3J36_06015) | - | 1352419..1352691 (+) | 273 | WP_027700037.1 | hypothetical protein | - |
| R3J36_RS06035 (R3J36_06020) | - | 1352766..1353065 (+) | 300 | WP_004084250.1 | hypothetical protein | - |
| R3J36_RS06040 (R3J36_06025) | - | 1353122..1353520 (+) | 399 | WP_027700038.1 | hypothetical protein | - |
| R3J36_RS06045 (R3J36_06030) | - | 1353777..1354568 (-) | 792 | WP_027700039.1 | DNA adenine methylase | - |
| R3J36_RS06050 (R3J36_06035) | - | 1354616..1354744 (+) | 129 | WP_256704593.1 | hypothetical protein | - |
| R3J36_RS06055 (R3J36_06040) | - | 1354804..1355466 (-) | 663 | WP_258057525.1 | hypothetical protein | - |
| R3J36_RS06060 (R3J36_06045) | - | 1355575..1355994 (-) | 420 | WP_004083636.1 | hypothetical protein | - |
| R3J36_RS06065 (R3J36_06050) | - | 1355998..1356510 (-) | 513 | WP_027700050.1 | hypothetical protein | - |
| R3J36_RS06070 (R3J36_06055) | - | 1356503..1359328 (-) | 2826 | WP_272819562.1 | phage tail protein | - |
| R3J36_RS06075 (R3J36_06060) | - | 1359318..1359554 (-) | 237 | WP_027700652.1 | hypothetical protein | - |
| R3J36_RS06080 (R3J36_06065) | - | 1359551..1359979 (-) | 429 | WP_004086822.1 | hypothetical protein | - |
| R3J36_RS06085 (R3J36_06070) | - | 1360106..1360396 (-) | 291 | WP_076613257.1 | hypothetical protein | - |
| R3J36_RS06090 (R3J36_06075) | - | 1360513..1361028 (-) | 516 | WP_027700653.1 | phage portal protein | - |
| R3J36_RS06095 (R3J36_06080) | - | 1361025..1361261 (-) | 237 | WP_012337727.1 | hypothetical protein | - |
| R3J36_RS06100 (R3J36_06085) | - | 1361338..1361982 (-) | 645 | WP_248638120.1 | terminase gpA endonuclease subunit | - |
| R3J36_RS06105 (R3J36_06090) | - | 1361918..1362265 (-) | 348 | WP_248638121.1 | CHC2 zinc finger domain-containing protein | - |
| R3J36_RS06110 (R3J36_06095) | - | 1362252..1363529 (-) | 1278 | WP_234499902.1 | transposase | - |
| R3J36_RS06115 (R3J36_06100) | - | 1363523..1364149 (-) | 627 | WP_140160998.1 | IS607 family transposase | - |
| R3J36_RS06120 (R3J36_06105) | - | 1364341..1364682 (+) | 342 | WP_228762220.1 | hypothetical protein | - |
| R3J36_RS06125 (R3J36_06110) | - | 1364679..1365137 (+) | 459 | WP_027700592.1 | DUF1566 domain-containing protein | - |
| R3J36_RS06130 (R3J36_06115) | - | 1365137..1365586 (+) | 450 | WP_027700593.1 | hypothetical protein | - |
| R3J36_RS06135 (R3J36_06120) | - | 1365583..1365804 (+) | 222 | WP_027700594.1 | hypothetical protein | - |
| R3J36_RS06140 (R3J36_06125) | - | 1365801..1366079 (+) | 279 | WP_027700595.1 | hypothetical protein | - |
| R3J36_RS06145 (R3J36_06130) | - | 1366076..1366342 (+) | 267 | WP_027700596.1 | hypothetical protein | - |
| R3J36_RS06150 (R3J36_06135) | - | 1366475..1367008 (+) | 534 | WP_004086585.1 | pilin | - |
| R3J36_RS06155 (R3J36_06140) | - | 1367101..1367694 (+) | 594 | WP_027700597.1 | DapH/DapD/GlmU-related protein | - |
| R3J36_RS06160 (R3J36_06145) | - | 1367691..1368224 (+) | 534 | WP_004083962.1 | hypothetical protein | - |
| R3J36_RS06165 (R3J36_06150) | - | 1368224..1368454 (+) | 231 | WP_021358635.1 | hypothetical protein | - |
| R3J36_RS06170 (R3J36_06155) | - | 1368447..1368917 (+) | 471 | WP_076613218.1 | DUF5131 family protein | - |
| R3J36_RS06175 (R3J36_06160) | ssb | 1368901..1369347 (+) | 447 | WP_021358633.1 | single-stranded DNA-binding protein | Machinery gene |
| R3J36_RS06180 (R3J36_06165) | - | 1369369..1369641 (+) | 273 | WP_004083966.1 | hypothetical protein | - |
| R3J36_RS06185 (R3J36_06170) | xerC | 1369641..1370813 (+) | 1173 | WP_004083967.1 | tyrosine recombinase XerC | - |
| R3J36_RS06190 (R3J36_06175) | - | 1371699..1372517 (+) | 819 | WP_027700598.1 | BglII/BstYI family type II restriction endonuclease | - |
| R3J36_RS06195 (R3J36_06180) | - | 1372514..1373206 (+) | 693 | WP_027700599.1 | MT-A70 family methyltransferase | - |
| R3J36_RS06200 (R3J36_06185) | - | 1373362..1373544 (-) | 183 | WP_038284140.1 | hypothetical protein | - |
| R3J36_RS06205 (R3J36_06190) | - | 1373898..1374902 (-) | 1005 | WP_027700600.1 | serine protease | - |
| R3J36_RS06210 (R3J36_06195) | - | 1375407..1376570 (-) | 1164 | WP_274169883.1 | phage tail protein | - |
| R3J36_RS06215 (R3J36_06200) | - | 1376574..1377134 (-) | 561 | WP_027700634.1 | DUF2612 domain-containing protein | - |
| R3J36_RS06220 (R3J36_06205) | - | 1377131..1378276 (-) | 1146 | WP_027700633.1 | baseplate J/gp47 family protein | - |
| R3J36_RS06225 (R3J36_06210) | - | 1378379..1378675 (+) | 297 | WP_004085590.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| R3J36_RS06230 (R3J36_06215) | - | 1378678..1378971 (+) | 294 | WP_004085592.1 | addiction module antidote protein | - |
| R3J36_RS06235 (R3J36_06220) | - | 1379027..1379380 (-) | 354 | WP_027700632.1 | hypothetical protein | - |
| R3J36_RS06240 (R3J36_06225) | - | 1379377..1380018 (-) | 642 | WP_012382583.1 | Gp138 family membrane-puncturing spike protein | - |
| R3J36_RS06245 (R3J36_06230) | - | 1380015..1380845 (-) | 831 | WP_027700631.1 | phage protein | - |
| R3J36_RS06250 (R3J36_06235) | - | 1380842..1381159 (-) | 318 | WP_012382585.1 | phage baseplate plug protein | - |
| R3J36_RS06255 (R3J36_06240) | - | 1381159..1381929 (-) | 771 | WP_274169884.1 | phage baseplate protein | - |
| R3J36_RS06260 (R3J36_06245) | - | 1382040..1382267 (+) | 228 | WP_004091377.1 | DUF6290 family protein | - |
| R3J36_RS06265 (R3J36_06250) | - | 1382251..1382517 (+) | 267 | WP_004087087.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| R3J36_RS06270 (R3J36_06255) | - | 1382528..1384417 (-) | 1890 | WP_274169885.1 | hypothetical protein | - |
| R3J36_RS06275 (R3J36_06260) | - | 1384565..1384819 (-) | 255 | WP_307846481.1 | phage tail assembly chaperone | - |
| R3J36_RS06280 (R3J36_06265) | - | 1384825..1385163 (-) | 339 | WP_274169886.1 | hypothetical protein | - |
| R3J36_RS06285 (R3J36_06270) | - | 1385173..1385655 (-) | 483 | WP_004090290.1 | hypothetical protein | - |
| R3J36_RS06290 (R3J36_06275) | - | 1385665..1386963 (-) | 1299 | WP_272819578.1 | DUF2213 domain-containing protein | - |
| R3J36_RS06295 (R3J36_06280) | - | 1386873..1387718 (-) | 846 | WP_274169887.1 | phage head morphogenesis protein | - |
| R3J36_RS06300 (R3J36_06285) | - | 1387791..1388129 (+) | 339 | WP_128723885.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| R3J36_RS06305 (R3J36_06290) | - | 1388126..1388407 (+) | 282 | WP_004085017.1 | helix-turn-helix domain-containing protein | - |
| R3J36_RS06310 (R3J36_06295) | - | 1388456..1389844 (-) | 1389 | WP_274169888.1 | DUF1073 domain-containing protein | - |
| R3J36_RS06315 (R3J36_06300) | terL | 1389841..1391391 (-) | 1551 | WP_027700655.1 | phage terminase large subunit | - |
| R3J36_RS06320 (R3J36_06305) | - | 1391342..1391740 (-) | 399 | WP_004086920.1 | hypothetical protein | - |
| R3J36_RS06325 (R3J36_06310) | - | 1391832..1392044 (-) | 213 | WP_040123254.1 | hypothetical protein | - |
| R3J36_RS06330 (R3J36_06315) | - | 1392046..1392507 (-) | 462 | WP_140162026.1 | hypothetical protein | - |
| R3J36_RS06335 (R3J36_06320) | - | 1392497..1392826 (-) | 330 | WP_004085022.1 | phage holin family protein | - |
| R3J36_RS06340 (R3J36_06325) | - | 1392819..1393319 (-) | 501 | WP_234499714.1 | lysozyme | - |
| R3J36_RS06345 (R3J36_06330) | - | 1393419..1394150 (-) | 732 | WP_234499874.1 | site-specific DNA-methyltransferase | - |
| R3J36_RS06350 (R3J36_06335) | - | 1394239..1394937 (-) | 699 | WP_375731608.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16536.38 Da Isoelectric Point: 6.4871
>NTDB_id=893932 R3J36_RS06175 WP_021358633.1 1368901..1369347(+) (ssb) [Xylella fastidiosa subsp. multiplex strain CFBP8068]
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGQDGQERYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGQDGQERYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
Nucleotide
Download Length: 447 bp
>NTDB_id=893932 R3J36_RS06175 WP_021358633.1 1368901..1369347(+) (ssb) [Xylella fastidiosa subsp. multiplex strain CFBP8068]
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTTGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCCAGGACGGTCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTTGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCCAGGACGGTCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
41.477 |
100 |
0.493 |
| ssb | Neisseria meningitidis MC58 |
38.728 |
100 |
0.453 |
| ssb | Neisseria gonorrhoeae MS11 |
38.728 |
100 |
0.453 |
| ssb | Glaesserella parasuis strain SC1401 |
41.304 |
93.243 |
0.385 |