Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | R3J28_RS03015 | Genome accession | NZ_CP136971 |
| Coordinates | 698041..698487 (-) | Length | 148 a.a. |
| NCBI ID | WP_021358633.1 | Uniprot ID | - |
| Organism | Xylella fastidiosa subsp. multiplex strain Santa29b | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 691212..712997 | 698041..698487 | within | 0 |
Gene organization within MGE regions
Location: 691212..712997
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R3J28_RS02975 (R3J28_02960) | - | 691212..692042 (-) | 831 | WP_004083974.1 | ABC transporter ATP-binding protein | - |
| R3J28_RS02980 (R3J28_02965) | - | 692048..693166 (-) | 1119 | WP_004083972.1 | ABC transporter permease | - |
| R3J28_RS02985 (R3J28_02970) | - | 693276..694538 (+) | 1263 | WP_012337721.1 | threonine/serine exporter ThrE family protein | - |
| R3J28_RS02990 (R3J28_02975) | - | 695179..695385 (+) | 207 | WP_071869858.1 | hypothetical protein | - |
| R3J28_RS02995 (R3J28_02980) | - | 695449..695661 (+) | 213 | WP_228304324.1 | hypothetical protein | - |
| R3J28_RS03000 (R3J28_02985) | - | 695725..695934 (+) | 210 | WP_225621843.1 | hypothetical protein | - |
| R3J28_RS03005 (R3J28_02990) | xerC | 696575..697747 (-) | 1173 | WP_004083967.1 | tyrosine recombinase XerC | - |
| R3J28_RS03010 (R3J28_02995) | - | 697747..698019 (-) | 273 | WP_004083966.1 | hypothetical protein | - |
| R3J28_RS03015 (R3J28_03000) | ssb | 698041..698487 (-) | 447 | WP_021358633.1 | single-stranded DNA-binding protein | Machinery gene |
| R3J28_RS03020 (R3J28_03005) | - | 698471..698920 (-) | 450 | WP_154128301.1 | DUF5131 family protein | - |
| R3J28_RS03025 (R3J28_03010) | - | 698913..699143 (-) | 231 | WP_021358635.1 | hypothetical protein | - |
| R3J28_RS03030 (R3J28_03015) | - | 699143..699676 (-) | 534 | WP_004083962.1 | hypothetical protein | - |
| R3J28_RS03035 (R3J28_03020) | - | 699673..700266 (-) | 594 | WP_004083960.1 | DapH/DapD/GlmU-related protein | - |
| R3J28_RS03040 (R3J28_03025) | - | 700359..700892 (-) | 534 | WP_012337723.1 | pilin | - |
| R3J28_RS03045 (R3J28_03030) | - | 701025..701291 (-) | 267 | WP_004084112.1 | hypothetical protein | - |
| R3J28_RS03050 (R3J28_03035) | - | 701288..701566 (-) | 279 | WP_004083957.1 | hypothetical protein | - |
| R3J28_RS03055 (R3J28_03040) | - | 701563..701784 (-) | 222 | WP_021358638.1 | hypothetical protein | - |
| R3J28_RS03060 (R3J28_03045) | - | 701781..702239 (-) | 459 | WP_004084109.1 | hypothetical protein | - |
| R3J28_RS03065 (R3J28_03050) | - | 702236..702700 (-) | 465 | WP_021358639.1 | DUF1566 domain-containing protein | - |
| R3J28_RS03070 (R3J28_03055) | - | 702697..703194 (-) | 498 | WP_021358640.1 | hypothetical protein | - |
| R3J28_RS03075 (R3J28_03060) | - | 703184..703807 (+) | 624 | WP_004083954.1 | hypothetical protein | - |
| R3J28_RS03080 (R3J28_03065) | - | 703909..704310 (-) | 402 | WP_004084104.1 | hypothetical protein | - |
| R3J28_RS03085 (R3J28_03070) | - | 704309..704797 (+) | 489 | WP_238836475.1 | CHC2 zinc finger domain-containing protein | - |
| R3J28_RS03090 (R3J28_03075) | - | 704733..705377 (+) | 645 | WP_228762222.1 | terminase gpA endonuclease subunit | - |
| R3J28_RS03095 (R3J28_03080) | - | 705454..705690 (+) | 237 | WP_375732123.1 | hypothetical protein | - |
| R3J28_RS03100 (R3J28_03085) | - | 705687..706202 (+) | 516 | WP_192442536.1 | phage portal protein | - |
| R3J28_RS03105 (R3J28_03090) | - | 706319..706609 (+) | 291 | WP_076613257.1 | hypothetical protein | - |
| R3J28_RS03110 (R3J28_03095) | - | 706736..707164 (+) | 429 | WP_004086822.1 | hypothetical protein | - |
| R3J28_RS03115 (R3J28_03100) | - | 707161..707397 (+) | 237 | WP_004083943.1 | hypothetical protein | - |
| R3J28_RS03120 (R3J28_03105) | - | 707387..710212 (+) | 2826 | WP_169709956.1 | phage tail protein | - |
| R3J28_RS03125 (R3J28_03110) | - | 710205..710717 (+) | 513 | WP_169709957.1 | hypothetical protein | - |
| R3J28_RS03130 (R3J28_03115) | - | 710721..711140 (+) | 420 | WP_004083636.1 | hypothetical protein | - |
| R3J28_RS03135 (R3J28_03120) | - | 711249..711911 (+) | 663 | WP_375732124.1 | hypothetical protein | - |
| R3J28_RS03140 | - | 712092..712274 (-) | 183 | WP_021358562.1 | hypothetical protein | - |
| R3J28_RS03150 (R3J28_03135) | - | 712746..712997 (+) | 252 | WP_004086775.1 | Panacea domain-containing protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16536.38 Da Isoelectric Point: 6.4871
>NTDB_id=893892 R3J28_RS03015 WP_021358633.1 698041..698487(-) (ssb) [Xylella fastidiosa subsp. multiplex strain Santa29b]
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGQDGQERYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGQDGQERYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
Nucleotide
Download Length: 447 bp
>NTDB_id=893892 R3J28_RS03015 WP_021358633.1 698041..698487(-) (ssb) [Xylella fastidiosa subsp. multiplex strain Santa29b]
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTTGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCCAGGACGGTCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTTGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCCAGGACGGTCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
41.477 |
100 |
0.493 |
| ssb | Neisseria meningitidis MC58 |
38.728 |
100 |
0.453 |
| ssb | Neisseria gonorrhoeae MS11 |
38.728 |
100 |
0.453 |
| ssb | Glaesserella parasuis strain SC1401 |
41.304 |
93.243 |
0.385 |