Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | R3J26_RS03075 | Genome accession | NZ_CP136970 |
| Coordinates | 706050..706496 (-) | Length | 148 a.a. |
| NCBI ID | WP_021358633.1 | Uniprot ID | - |
| Organism | Xylella fastidiosa subsp. multiplex strain XF3348 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 696824..725432 | 706050..706496 | within | 0 |
Gene organization within MGE regions
Location: 696824..725432
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R3J26_RS03020 (R3J26_03010) | - | 696866..697450 (+) | 585 | WP_004083991.1 | alpha-ketoglutarate-dependent dioxygenase AlkB | - |
| R3J26_RS03025 (R3J26_03015) | - | 697645..698286 (-) | 642 | WP_004083987.1 | ABC-type transport auxiliary lipoprotein family protein | - |
| R3J26_RS03030 (R3J26_03020) | - | 698283..699209 (-) | 927 | WP_004083985.1 | MlaD family protein | - |
| R3J26_RS03035 (R3J26_03025) | - | 699213..700043 (-) | 831 | WP_004083974.1 | ABC transporter ATP-binding protein | - |
| R3J26_RS03040 (R3J26_03030) | - | 700049..701167 (-) | 1119 | WP_004083972.1 | ABC transporter permease | - |
| R3J26_RS03045 (R3J26_03035) | - | 701277..702539 (+) | 1263 | WP_012337721.1 | threonine/serine exporter ThrE family protein | - |
| R3J26_RS03050 (R3J26_03040) | - | 703180..703386 (+) | 207 | WP_071869858.1 | hypothetical protein | - |
| R3J26_RS03055 (R3J26_03045) | - | 703450..703605 (+) | 156 | WP_225621844.1 | hypothetical protein | - |
| R3J26_RS03060 (R3J26_03050) | - | 703734..703943 (+) | 210 | WP_225621843.1 | hypothetical protein | - |
| R3J26_RS03065 (R3J26_03055) | xerC | 704584..705756 (-) | 1173 | WP_004083967.1 | tyrosine recombinase XerC | - |
| R3J26_RS03070 (R3J26_03060) | - | 705756..706028 (-) | 273 | WP_004083966.1 | hypothetical protein | - |
| R3J26_RS03075 (R3J26_03065) | ssb | 706050..706496 (-) | 447 | WP_021358633.1 | single-stranded DNA-binding protein | Machinery gene |
| R3J26_RS03080 (R3J26_03070) | - | 706480..706929 (-) | 450 | WP_154128301.1 | DUF5131 family protein | - |
| R3J26_RS03085 (R3J26_03075) | - | 706922..707152 (-) | 231 | WP_021358635.1 | hypothetical protein | - |
| R3J26_RS03090 (R3J26_03080) | - | 707152..707685 (-) | 534 | WP_004083962.1 | hypothetical protein | - |
| R3J26_RS03095 (R3J26_03085) | - | 707682..708275 (-) | 594 | WP_004083960.1 | DapH/DapD/GlmU-related protein | - |
| R3J26_RS03100 (R3J26_03090) | - | 708368..708901 (-) | 534 | WP_012337723.1 | pilin | - |
| R3J26_RS03105 (R3J26_03095) | - | 709034..709300 (-) | 267 | WP_004084112.1 | hypothetical protein | - |
| R3J26_RS03110 (R3J26_03100) | - | 709297..709575 (-) | 279 | WP_004083957.1 | hypothetical protein | - |
| R3J26_RS03115 (R3J26_03105) | - | 709572..709793 (-) | 222 | WP_021358638.1 | hypothetical protein | - |
| R3J26_RS03120 (R3J26_03110) | - | 709790..710248 (-) | 459 | WP_004084109.1 | hypothetical protein | - |
| R3J26_RS03125 (R3J26_03115) | - | 710245..710709 (-) | 465 | WP_021358639.1 | DUF1566 domain-containing protein | - |
| R3J26_RS03130 (R3J26_03120) | - | 710706..711203 (-) | 498 | WP_021358640.1 | hypothetical protein | - |
| R3J26_RS03135 (R3J26_03125) | - | 711193..711816 (+) | 624 | WP_004083954.1 | hypothetical protein | - |
| R3J26_RS03140 (R3J26_03130) | - | 711918..712319 (-) | 402 | WP_004084104.1 | hypothetical protein | - |
| R3J26_RS03145 (R3J26_03135) | - | 712318..712806 (+) | 489 | WP_238836475.1 | CHC2 zinc finger domain-containing protein | - |
| R3J26_RS03150 (R3J26_03140) | - | 712742..713386 (+) | 645 | WP_228762222.1 | terminase gpA endonuclease subunit | - |
| R3J26_RS03155 (R3J26_03145) | - | 713463..713699 (+) | 237 | WP_012337727.1 | hypothetical protein | - |
| R3J26_RS03160 (R3J26_03150) | - | 713696..714211 (+) | 516 | WP_004083947.1 | phage portal protein | - |
| R3J26_RS03165 (R3J26_03155) | - | 714376..714618 (+) | 243 | WP_228762223.1 | hypothetical protein | - |
| R3J26_RS03170 (R3J26_03160) | - | 714745..715173 (+) | 429 | WP_004083945.1 | hypothetical protein | - |
| R3J26_RS03175 (R3J26_03165) | - | 715170..715406 (+) | 237 | WP_004083943.1 | hypothetical protein | - |
| R3J26_RS03180 (R3J26_03170) | - | 715396..718221 (+) | 2826 | WP_169709956.1 | phage tail protein | - |
| R3J26_RS03185 (R3J26_03175) | - | 718214..718726 (+) | 513 | WP_169709957.1 | hypothetical protein | - |
| R3J26_RS03190 (R3J26_03180) | - | 718730..719149 (+) | 420 | WP_004083636.1 | hypothetical protein | - |
| R3J26_RS03195 (R3J26_03185) | - | 719225..719920 (+) | 696 | WP_162008345.1 | hypothetical protein | - |
| R3J26_RS03200 (R3J26_03190) | - | 719883..720089 (-) | 207 | WP_273972798.1 | hypothetical protein | - |
| R3J26_RS03205 (R3J26_03195) | - | 720156..720263 (+) | 108 | Protein_611 | DNA adenine methylase | - |
| R3J26_RS03210 (R3J26_03200) | - | 720315..720941 (+) | 627 | WP_038230952.1 | IS607 family transposase | - |
| R3J26_RS03215 (R3J26_03205) | - | 720935..722131 (+) | 1197 | WP_004083925.1 | RNA-guided endonuclease TnpB family protein | - |
| R3J26_RS03220 (R3J26_03210) | - | 722159..722842 (+) | 684 | Protein_614 | DNA adenine methylase | - |
| R3J26_RS03225 (R3J26_03215) | - | 723561..723860 (-) | 300 | WP_004084250.1 | hypothetical protein | - |
| R3J26_RS03230 (R3J26_03220) | - | 724220..724462 (-) | 243 | WP_020851762.1 | hypothetical protein | - |
| R3J26_RS03235 (R3J26_03225) | - | 724868..725161 (-) | 294 | WP_234759377.1 | BrnA antitoxin family protein | - |
| R3J26_RS03240 (R3J26_03230) | - | 725145..725432 (-) | 288 | WP_004083921.1 | BrnT family toxin | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16536.38 Da Isoelectric Point: 6.4871
>NTDB_id=893875 R3J26_RS03075 WP_021358633.1 706050..706496(-) (ssb) [Xylella fastidiosa subsp. multiplex strain XF3348]
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGQDGQERYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGQDGQERYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
Nucleotide
Download Length: 447 bp
>NTDB_id=893875 R3J26_RS03075 WP_021358633.1 706050..706496(-) (ssb) [Xylella fastidiosa subsp. multiplex strain XF3348]
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTTGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCCAGGACGGTCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTTGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCCAGGACGGTCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
41.477 |
100 |
0.493 |
| ssb | Neisseria meningitidis MC58 |
38.728 |
100 |
0.453 |
| ssb | Neisseria gonorrhoeae MS11 |
38.728 |
100 |
0.453 |
| ssb | Glaesserella parasuis strain SC1401 |
41.304 |
93.243 |
0.385 |