Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | R3J25_RS03140 | Genome accession | NZ_CP136969 |
| Coordinates | 715170..715616 (-) | Length | 148 a.a. |
| NCBI ID | WP_021358633.1 | Uniprot ID | - |
| Organism | Xylella fastidiosa subsp. multiplex strain XYL1752/17 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 705944..734552 | 715170..715616 | within | 0 |
Gene organization within MGE regions
Location: 705944..734552
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R3J25_RS03085 (R3J25_03080) | - | 705986..706570 (+) | 585 | WP_004083991.1 | alpha-ketoglutarate-dependent dioxygenase AlkB | - |
| R3J25_RS03090 (R3J25_03085) | - | 706765..707406 (-) | 642 | WP_004083987.1 | ABC-type transport auxiliary lipoprotein family protein | - |
| R3J25_RS03095 (R3J25_03090) | - | 707403..708329 (-) | 927 | WP_004083985.1 | MlaD family protein | - |
| R3J25_RS03100 (R3J25_03095) | - | 708333..709163 (-) | 831 | WP_004083974.1 | ABC transporter ATP-binding protein | - |
| R3J25_RS03105 (R3J25_03100) | - | 709169..710287 (-) | 1119 | WP_004083972.1 | ABC transporter permease | - |
| R3J25_RS03110 (R3J25_03105) | - | 710397..711659 (+) | 1263 | WP_012337721.1 | threonine/serine exporter ThrE family protein | - |
| R3J25_RS03115 (R3J25_03110) | - | 712300..712506 (+) | 207 | WP_071869858.1 | hypothetical protein | - |
| R3J25_RS03120 (R3J25_03115) | - | 712570..712725 (+) | 156 | WP_225621844.1 | hypothetical protein | - |
| R3J25_RS03125 (R3J25_03120) | - | 712854..713063 (+) | 210 | WP_225621843.1 | hypothetical protein | - |
| R3J25_RS03130 (R3J25_03125) | xerC | 713704..714876 (-) | 1173 | WP_004083967.1 | tyrosine recombinase XerC | - |
| R3J25_RS03135 (R3J25_03130) | - | 714876..715148 (-) | 273 | WP_004083966.1 | hypothetical protein | - |
| R3J25_RS03140 (R3J25_03135) | ssb | 715170..715616 (-) | 447 | WP_021358633.1 | single-stranded DNA-binding protein | Machinery gene |
| R3J25_RS03145 (R3J25_03140) | - | 715600..716049 (-) | 450 | WP_154128301.1 | DUF5131 family protein | - |
| R3J25_RS03150 (R3J25_03145) | - | 716042..716272 (-) | 231 | WP_021358635.1 | hypothetical protein | - |
| R3J25_RS03155 (R3J25_03150) | - | 716272..716805 (-) | 534 | WP_004083962.1 | hypothetical protein | - |
| R3J25_RS03160 (R3J25_03155) | - | 716802..717395 (-) | 594 | WP_004083960.1 | DapH/DapD/GlmU-related protein | - |
| R3J25_RS03165 (R3J25_03160) | - | 717488..718021 (-) | 534 | WP_012337723.1 | pilin | - |
| R3J25_RS03170 (R3J25_03165) | - | 718154..718420 (-) | 267 | WP_004084112.1 | hypothetical protein | - |
| R3J25_RS03175 (R3J25_03170) | - | 718417..718695 (-) | 279 | WP_004083957.1 | hypothetical protein | - |
| R3J25_RS03180 (R3J25_03175) | - | 718692..718913 (-) | 222 | WP_021358638.1 | hypothetical protein | - |
| R3J25_RS03185 (R3J25_03180) | - | 718910..719368 (-) | 459 | WP_004084109.1 | hypothetical protein | - |
| R3J25_RS03190 (R3J25_03185) | - | 719365..719829 (-) | 465 | WP_021358639.1 | DUF1566 domain-containing protein | - |
| R3J25_RS03195 (R3J25_03190) | - | 719826..720323 (-) | 498 | WP_021358640.1 | hypothetical protein | - |
| R3J25_RS03200 (R3J25_03195) | - | 720313..720936 (+) | 624 | WP_004083954.1 | hypothetical protein | - |
| R3J25_RS03205 (R3J25_03200) | - | 721038..721439 (-) | 402 | WP_004084104.1 | hypothetical protein | - |
| R3J25_RS03210 (R3J25_03205) | - | 721438..721926 (+) | 489 | WP_238836475.1 | CHC2 zinc finger domain-containing protein | - |
| R3J25_RS03215 (R3J25_03210) | - | 721862..722506 (+) | 645 | WP_228762222.1 | terminase gpA endonuclease subunit | - |
| R3J25_RS03220 (R3J25_03215) | - | 722583..722819 (+) | 237 | WP_012337727.1 | hypothetical protein | - |
| R3J25_RS03225 (R3J25_03220) | - | 722816..723331 (+) | 516 | WP_004083947.1 | phage portal protein | - |
| R3J25_RS03230 (R3J25_03225) | - | 723448..723738 (+) | 291 | WP_076613257.1 | hypothetical protein | - |
| R3J25_RS03235 (R3J25_03230) | - | 723865..724293 (+) | 429 | WP_004083945.1 | hypothetical protein | - |
| R3J25_RS03240 (R3J25_03235) | - | 724290..724526 (+) | 237 | WP_004083943.1 | hypothetical protein | - |
| R3J25_RS03245 (R3J25_03240) | - | 724516..727341 (+) | 2826 | WP_169709956.1 | phage tail protein | - |
| R3J25_RS03250 (R3J25_03245) | - | 727334..727846 (+) | 513 | WP_169709957.1 | hypothetical protein | - |
| R3J25_RS03255 (R3J25_03250) | - | 727850..728269 (+) | 420 | WP_004083636.1 | hypothetical protein | - |
| R3J25_RS03260 (R3J25_03255) | - | 728345..729040 (+) | 696 | WP_162008345.1 | hypothetical protein | - |
| R3J25_RS03265 (R3J25_03260) | - | 729003..729209 (-) | 207 | WP_273972798.1 | hypothetical protein | - |
| R3J25_RS03270 (R3J25_03265) | - | 729276..729383 (+) | 108 | Protein_624 | DNA adenine methylase | - |
| R3J25_RS03275 (R3J25_03270) | - | 729435..730061 (+) | 627 | WP_038230952.1 | IS607 family transposase | - |
| R3J25_RS03280 (R3J25_03275) | - | 730055..731251 (+) | 1197 | WP_004083925.1 | RNA-guided endonuclease TnpB family protein | - |
| R3J25_RS03285 (R3J25_03280) | - | 731279..731962 (+) | 684 | Protein_627 | DNA adenine methylase | - |
| R3J25_RS03290 (R3J25_03285) | - | 732681..732980 (-) | 300 | WP_004084250.1 | hypothetical protein | - |
| R3J25_RS03295 (R3J25_03290) | - | 733340..733582 (-) | 243 | WP_020851762.1 | hypothetical protein | - |
| R3J25_RS03300 (R3J25_03295) | - | 733988..734305 (-) | 318 | WP_004084245.1 | BrnA antitoxin family protein | - |
| R3J25_RS03305 (R3J25_03300) | - | 734265..734552 (-) | 288 | WP_004083921.1 | BrnT family toxin | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16536.38 Da Isoelectric Point: 6.4871
>NTDB_id=893858 R3J25_RS03140 WP_021358633.1 715170..715616(-) (ssb) [Xylella fastidiosa subsp. multiplex strain XYL1752/17]
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGQDGQERYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGQDGQERYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
Nucleotide
Download Length: 447 bp
>NTDB_id=893858 R3J25_RS03140 WP_021358633.1 715170..715616(-) (ssb) [Xylella fastidiosa subsp. multiplex strain XYL1752/17]
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTTGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCCAGGACGGTCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTTGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCCAGGACGGTCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
41.477 |
100 |
0.493 |
| ssb | Neisseria meningitidis MC58 |
38.728 |
100 |
0.453 |
| ssb | Neisseria gonorrhoeae MS11 |
38.728 |
100 |
0.453 |
| ssb | Glaesserella parasuis strain SC1401 |
41.304 |
93.243 |
0.385 |