Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   RX793_RS17330 Genome accession   NZ_CP136263
Coordinates   3524992..3525165 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain 0039     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3519992..3530165
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RX793_RS17280 (RX793_17250) comGD 3520112..3520549 (+) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene
  RX793_RS17285 (RX793_17255) comGE 3520533..3520847 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  RX793_RS17290 (RX793_17260) comGF 3520861..3521256 (+) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  RX793_RS17295 (RX793_17265) comGG 3521257..3521634 (+) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  RX793_RS17300 (RX793_17270) - 3521691..3521870 (+) 180 WP_003153093.1 YqzE family protein -
  RX793_RS17305 (RX793_17275) - 3521910..3522239 (-) 330 WP_024085599.1 DUF3889 domain-containing protein -
  RX793_RS17310 (RX793_17280) tapA 3522499..3523170 (+) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  RX793_RS17315 (RX793_17285) sipW 3523142..3523726 (+) 585 WP_003153100.1 signal peptidase I SipW -
  RX793_RS17320 (RX793_17290) tasA 3523790..3524575 (+) 786 WP_015388008.1 biofilm matrix protein TasA -
  RX793_RS17325 (RX793_17295) sinR 3524623..3524958 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RX793_RS17330 (RX793_17300) sinI 3524992..3525165 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  RX793_RS17335 (RX793_17305) - 3525342..3526136 (-) 795 WP_003153106.1 YqhG family protein -
  RX793_RS17340 (RX793_17310) - 3526154..3527824 (-) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  RX793_RS17345 (RX793_17315) gcvT 3528247..3529347 (+) 1101 WP_024085597.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=890017 RX793_RS17330 WP_003153105.1 3524992..3525165(-) (sinI) [Bacillus velezensis strain 0039]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=890017 RX793_RS17330 WP_003153105.1 3524992..3525165(-) (sinI) [Bacillus velezensis strain 0039]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702