Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | RX793_RS17330 | Genome accession | NZ_CP136263 |
| Coordinates | 3524992..3525165 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain 0039 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3519992..3530165
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RX793_RS17280 (RX793_17250) | comGD | 3520112..3520549 (+) | 438 | WP_024085600.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| RX793_RS17285 (RX793_17255) | comGE | 3520533..3520847 (+) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| RX793_RS17290 (RX793_17260) | comGF | 3520861..3521256 (+) | 396 | WP_003153090.1 | competence type IV pilus minor pilin ComGF | - |
| RX793_RS17295 (RX793_17265) | comGG | 3521257..3521634 (+) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| RX793_RS17300 (RX793_17270) | - | 3521691..3521870 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| RX793_RS17305 (RX793_17275) | - | 3521910..3522239 (-) | 330 | WP_024085599.1 | DUF3889 domain-containing protein | - |
| RX793_RS17310 (RX793_17280) | tapA | 3522499..3523170 (+) | 672 | WP_024085598.1 | amyloid fiber anchoring/assembly protein TapA | - |
| RX793_RS17315 (RX793_17285) | sipW | 3523142..3523726 (+) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| RX793_RS17320 (RX793_17290) | tasA | 3523790..3524575 (+) | 786 | WP_015388008.1 | biofilm matrix protein TasA | - |
| RX793_RS17325 (RX793_17295) | sinR | 3524623..3524958 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| RX793_RS17330 (RX793_17300) | sinI | 3524992..3525165 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| RX793_RS17335 (RX793_17305) | - | 3525342..3526136 (-) | 795 | WP_003153106.1 | YqhG family protein | - |
| RX793_RS17340 (RX793_17310) | - | 3526154..3527824 (-) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| RX793_RS17345 (RX793_17315) | gcvT | 3528247..3529347 (+) | 1101 | WP_024085597.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=890017 RX793_RS17330 WP_003153105.1 3524992..3525165(-) (sinI) [Bacillus velezensis strain 0039]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=890017 RX793_RS17330 WP_003153105.1 3524992..3525165(-) (sinI) [Bacillus velezensis strain 0039]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |