Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   RX793_RS17295 Genome accession   NZ_CP136263
Coordinates   3521257..3521634 (+) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus velezensis strain 0039     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3516257..3526634
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RX793_RS17260 (RX793_17230) - 3516573..3517523 (+) 951 WP_014305415.1 magnesium transporter CorA family protein -
  RX793_RS17265 (RX793_17235) comGA 3517715..3518785 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  RX793_RS17270 (RX793_17240) comGB 3518772..3519809 (+) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  RX793_RS17275 (RX793_17245) comGC 3519814..3520122 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  RX793_RS17280 (RX793_17250) comGD 3520112..3520549 (+) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene
  RX793_RS17285 (RX793_17255) comGE 3520533..3520847 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  RX793_RS17290 (RX793_17260) comGF 3520861..3521256 (+) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  RX793_RS17295 (RX793_17265) comGG 3521257..3521634 (+) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  RX793_RS17300 (RX793_17270) - 3521691..3521870 (+) 180 WP_003153093.1 YqzE family protein -
  RX793_RS17305 (RX793_17275) - 3521910..3522239 (-) 330 WP_024085599.1 DUF3889 domain-containing protein -
  RX793_RS17310 (RX793_17280) tapA 3522499..3523170 (+) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  RX793_RS17315 (RX793_17285) sipW 3523142..3523726 (+) 585 WP_003153100.1 signal peptidase I SipW -
  RX793_RS17320 (RX793_17290) tasA 3523790..3524575 (+) 786 WP_015388008.1 biofilm matrix protein TasA -
  RX793_RS17325 (RX793_17295) sinR 3524623..3524958 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RX793_RS17330 (RX793_17300) sinI 3524992..3525165 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  RX793_RS17335 (RX793_17305) - 3525342..3526136 (-) 795 WP_003153106.1 YqhG family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=890015 RX793_RS17295 WP_003153092.1 3521257..3521634(+) (comGG) [Bacillus velezensis strain 0039]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=890015 RX793_RS17295 WP_003153092.1 3521257..3521634(+) (comGG) [Bacillus velezensis strain 0039]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512