Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   RUI02_RS12340 Genome accession   NZ_CP136099
Coordinates   2401567..2401950 (-) Length   127 a.a.
NCBI ID   WP_046160582.1    Uniprot ID   A0AA96UKP5
Organism   Bacillus sp. TSA-4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2396567..2406950
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RUI02_RS12300 (RUI02_12300) sinI 2397500..2397673 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  RUI02_RS12305 (RUI02_12305) sinR 2397707..2398042 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RUI02_RS12310 (RUI02_12310) tasA 2398135..2398920 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  RUI02_RS12315 (RUI02_12315) sipW 2398984..2399556 (-) 573 WP_003230181.1 signal peptidase I SipW -
  RUI02_RS12320 (RUI02_12320) tapA 2399540..2400301 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  RUI02_RS12325 (RUI02_12325) - 2400573..2400899 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  RUI02_RS12330 (RUI02_12330) - 2400941..2401120 (-) 180 WP_029726723.1 YqzE family protein -
  RUI02_RS12335 (RUI02_12335) comGG 2401192..2401566 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  RUI02_RS12340 (RUI02_12340) comGF 2401567..2401950 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  RUI02_RS12345 (RUI02_12345) comGE 2401976..2402323 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene
  RUI02_RS12350 (RUI02_12350) comGD 2402307..2402738 (-) 432 WP_046381179.1 comG operon protein ComGD Machinery gene
  RUI02_RS12355 (RUI02_12355) comGC 2402728..2403024 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  RUI02_RS12360 (RUI02_12360) comGB 2403038..2404075 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  RUI02_RS12365 (RUI02_12365) comGA 2404062..2405132 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  RUI02_RS12370 (RUI02_12370) - 2405344..2405541 (-) 198 WP_014480259.1 CBS domain-containing protein -
  RUI02_RS12375 (RUI02_12375) corA 2405543..2406496 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14306.38 Da        Isoelectric Point: 5.5289

>NTDB_id=888415 RUI02_RS12340 WP_046160582.1 2401567..2401950(-) (comGF) [Bacillus sp. TSA-4]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYQSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=888415 RUI02_RS12340 WP_046160582.1 2401567..2401950(-) (comGF) [Bacillus sp. TSA-4]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCAATCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984