Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   RUI02_RS12300 Genome accession   NZ_CP136099
Coordinates   2397500..2397673 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. TSA-4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2392500..2402673
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RUI02_RS12285 (RUI02_12285) gcvT 2393299..2394387 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  RUI02_RS12290 (RUI02_12290) - 2394829..2396502 (+) 1674 WP_003230203.1 DEAD/DEAH box helicase -
  RUI02_RS12295 (RUI02_12295) - 2396523..2397317 (+) 795 WP_003230200.1 YqhG family protein -
  RUI02_RS12300 (RUI02_12300) sinI 2397500..2397673 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  RUI02_RS12305 (RUI02_12305) sinR 2397707..2398042 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RUI02_RS12310 (RUI02_12310) tasA 2398135..2398920 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  RUI02_RS12315 (RUI02_12315) sipW 2398984..2399556 (-) 573 WP_003230181.1 signal peptidase I SipW -
  RUI02_RS12320 (RUI02_12320) tapA 2399540..2400301 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  RUI02_RS12325 (RUI02_12325) - 2400573..2400899 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  RUI02_RS12330 (RUI02_12330) - 2400941..2401120 (-) 180 WP_029726723.1 YqzE family protein -
  RUI02_RS12335 (RUI02_12335) comGG 2401192..2401566 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  RUI02_RS12340 (RUI02_12340) comGF 2401567..2401950 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  RUI02_RS12345 (RUI02_12345) comGE 2401976..2402323 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=888412 RUI02_RS12300 WP_003230187.1 2397500..2397673(+) (sinI) [Bacillus sp. TSA-4]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=888412 RUI02_RS12300 WP_003230187.1 2397500..2397673(+) (sinI) [Bacillus sp. TSA-4]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1