Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   MGAS37823_RS00680 Genome accession   NZ_CP151463
Coordinates   104672..104956 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain MGAS37823     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99672..109956
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MGAS37823_RS00655 (MGAS37823_00266) - 101618..101983 (+) 366 WP_002986560.1 DUF1033 family protein -
  MGAS37823_RS00660 (MGAS37823_00268) comGA 102076..103014 (+) 939 WP_010921798.1 competence type IV pilus ATPase ComGA Machinery gene
  MGAS37823_RS00665 (MGAS37823_00270) comGB 102950..103984 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  MGAS37823_RS00670 (MGAS37823_00272) comGC 103986..104312 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  MGAS37823_RS00675 (MGAS37823_00274) comGD 104287..104715 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  MGAS37823_RS00680 (MGAS37823_00276) comGE 104672..104956 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  MGAS37823_RS00685 (MGAS37823_00278) comGF 104949..105383 (+) 435 WP_010921800.1 competence type IV pilus minor pilin ComGF Machinery gene
  MGAS37823_RS00690 (MGAS37823_00280) comGG 105367..105693 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  MGAS37823_RS00695 (MGAS37823_00282) comGH 105791..106744 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  MGAS37823_RS00700 (MGAS37823_00284) - 106803..107999 (+) 1197 WP_010921803.1 acetate kinase -
  MGAS37823_RS00705 - 108186..108494 (+) 309 WP_010921804.1 hypothetical protein -
  MGAS37823_RS00710 (MGAS37823_00286) proC 108577..109347 (-) 771 WP_010921805.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=887625 MGAS37823_RS00680 WP_002987779.1 104672..104956(+) (comGE) [Streptococcus pyogenes strain MGAS37823]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=887625 MGAS37823_RS00680 WP_002987779.1 104672..104956(+) (comGE) [Streptococcus pyogenes strain MGAS37823]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383