Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   RRF59_RS13860 Genome accession   NZ_CP135622
Coordinates   2814636..2815097 (+) Length   153 a.a.
NCBI ID   WP_134215761.1    Uniprot ID   -
Organism   Citrobacter freundii strain 202212     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2775350..2819811 2814636..2815097 within 0


Gene organization within MGE regions


Location: 2775350..2819811
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RRF59_RS13555 (RRF59_13560) - 2775350..2777791 (-) 2442 WP_232051944.1 hypothetical protein -
  RRF59_RS13560 (RRF59_13565) - 2777850..2780327 (-) 2478 WP_134215675.1 host specificity factor TipJ family phage tail protein -
  RRF59_RS13565 (RRF59_13570) - 2780314..2780679 (-) 366 WP_134216477.1 NlpC/P60 family protein -
  RRF59_RS13570 (RRF59_13575) - 2780693..2781163 (-) 471 WP_134215677.1 hypothetical protein -
  RRF59_RS13575 (RRF59_13580) - 2781163..2781660 (-) 498 WP_134215679.1 hypothetical protein -
  RRF59_RS13580 (RRF59_13585) - 2781660..2785145 (-) 3486 WP_134215682.1 tape measure protein -
  RRF59_RS13585 (RRF59_13590) - 2785204..2785887 (-) 684 WP_134215684.1 DUF6246 family protein -
  RRF59_RS13590 (RRF59_13595) - 2785947..2786690 (-) 744 WP_057058152.1 Ig-like domain-containing protein -
  RRF59_RS13595 (RRF59_13600) - 2786753..2787136 (-) 384 WP_134215688.1 hypothetical protein -
  RRF59_RS13600 (RRF59_13605) - 2787133..2787501 (-) 369 WP_134215690.1 HK97 gp10 family phage protein -
  RRF59_RS13605 (RRF59_13610) - 2787504..2787854 (-) 351 WP_006808949.1 hypothetical protein -
  RRF59_RS13610 (RRF59_13615) - 2787847..2788242 (-) 396 WP_232051945.1 DUF6527 family protein -
  RRF59_RS13615 (RRF59_13620) - 2788349..2788729 (-) 381 WP_134215695.1 hypothetical protein -
  RRF59_RS13620 (RRF59_13625) - 2788806..2789093 (-) 288 WP_134215697.1 hypothetical protein -
  RRF59_RS13625 (RRF59_13630) - 2789133..2790164 (-) 1032 WP_134215698.1 major capsid protein -
  RRF59_RS13630 (RRF59_13635) - 2790176..2790610 (-) 435 WP_134215699.1 hypothetical protein -
  RRF59_RS13635 (RRF59_13640) - 2790610..2792004 (-) 1395 WP_240210296.1 DUF2213 domain-containing protein -
  RRF59_RS13640 (RRF59_13645) - 2792023..2792217 (-) 195 WP_240210297.1 hypothetical protein -
  RRF59_RS13645 (RRF59_13650) - 2792214..2793221 (-) 1008 WP_240210298.1 phage minor head protein -
  RRF59_RS13650 (RRF59_13655) - 2793148..2794617 (-) 1470 WP_240210299.1 DUF1073 domain-containing protein -
  RRF59_RS13655 (RRF59_13660) - 2794630..2796102 (-) 1473 WP_268052021.1 terminase -
  RRF59_RS13660 (RRF59_13665) - 2796102..2796704 (-) 603 WP_240210301.1 hypothetical protein -
  RRF59_RS13665 (RRF59_13670) - 2796720..2796950 (-) 231 WP_240210302.1 hypothetical protein -
  RRF59_RS13670 (RRF59_13675) - 2796947..2797441 (-) 495 WP_240210303.1 tail needle knob protein -
  RRF59_RS27765 - 2797445..2797651 (-) 207 Protein_2684 hypothetical protein -
  RRF59_RS13680 (RRF59_13685) - 2797817..2797951 (+) 135 WP_258980713.1 hypothetical protein -
  RRF59_RS13685 (RRF59_13690) - 2797965..2798483 (-) 519 WP_149911422.1 Rha family transcriptional regulator -
  RRF59_RS13690 (RRF59_13695) - 2798690..2799151 (-) 462 WP_240210304.1 lysis protein -
  RRF59_RS13695 (RRF59_13700) - 2799148..2799642 (-) 495 WP_275380716.1 lysozyme -
  RRF59_RS13700 (RRF59_13705) - 2799614..2799817 (-) 204 WP_063812804.1 phage holin family protein -
  RRF59_RS13710 (RRF59_13715) - 2800180..2800869 (-) 690 WP_240210305.1 bacteriophage antitermination protein Q -
  RRF59_RS13715 (RRF59_13720) - 2800869..2801006 (-) 138 WP_106672179.1 YlcG family protein -
  RRF59_RS13720 (RRF59_13725) - 2801003..2801608 (-) 606 WP_240210306.1 recombination protein NinG -
  RRF59_RS13725 (RRF59_13730) - 2801601..2802269 (-) 669 WP_240210307.1 serine/threonine protein phosphatase -
  RRF59_RS13730 (RRF59_13735) - 2802266..2802436 (-) 171 WP_240210308.1 NinE family protein -
  RRF59_RS13735 (RRF59_13740) - 2802429..2802878 (-) 450 WP_172751003.1 recombination protein NinB -
  RRF59_RS13740 (RRF59_13745) - 2803288..2803941 (-) 654 WP_240210309.1 hypothetical protein -
  RRF59_RS13745 (RRF59_13750) - 2803941..2804222 (-) 282 WP_071444859.1 hypothetical protein -
  RRF59_RS13750 (RRF59_13755) - 2804219..2804545 (-) 327 WP_071444858.1 hypothetical protein -
  RRF59_RS13755 (RRF59_13760) - 2804542..2804772 (-) 231 WP_071444857.1 hypothetical protein -
  RRF59_RS13760 (RRF59_13765) - 2804774..2805100 (-) 327 WP_240210310.1 hypothetical protein -
  RRF59_RS13765 (RRF59_13770) - 2805102..2805536 (-) 435 WP_232051946.1 ead/Ea22-like family protein -
  RRF59_RS13770 (RRF59_13775) - 2805533..2805745 (-) 213 WP_240210311.1 hypothetical protein -
  RRF59_RS13775 (RRF59_13780) - 2805742..2806170 (-) 429 WP_232051947.1 hypothetical protein -
  RRF59_RS13780 (RRF59_13785) - 2806210..2806446 (-) 237 WP_134215741.1 hypothetical protein -
  RRF59_RS13785 (RRF59_13790) - 2806732..2807034 (-) 303 WP_134215744.1 hypothetical protein -
  RRF59_RS13790 (RRF59_13795) - 2807034..2808467 (-) 1434 WP_240210312.1 DnaB-like helicase C-terminal domain-containing protein -
  RRF59_RS13795 (RRF59_13800) - 2808457..2809353 (-) 897 WP_134215748.1 DNA replication protein -
  RRF59_RS13800 (RRF59_13805) - 2809346..2809489 (-) 144 WP_134215750.1 DUF2740 family protein -
  RRF59_RS13805 (RRF59_13810) - 2809515..2809814 (-) 300 WP_134215752.1 CII family transcriptional regulator -
  RRF59_RS13810 (RRF59_13815) - 2809954..2810184 (-) 231 WP_052928615.1 hypothetical protein -
  RRF59_RS13815 (RRF59_13820) - 2810264..2810971 (+) 708 WP_134216479.1 helix-turn-helix transcriptional regulator -
  RRF59_RS13820 (RRF59_13825) - 2811485..2811745 (+) 261 WP_110820164.1 hypothetical protein -
  RRF59_RS13825 (RRF59_13830) - 2811907..2812149 (+) 243 WP_134215754.1 hypothetical protein -
  RRF59_RS13830 (RRF59_13835) - 2812146..2812304 (+) 159 WP_172616062.1 hypothetical protein -
  RRF59_RS13835 (RRF59_13840) - 2812301..2812510 (+) 210 WP_134215756.1 cell division protein FtsZ -
  RRF59_RS13840 (RRF59_13845) - 2812582..2813553 (+) 972 WP_134215757.1 hypothetical protein -
  RRF59_RS13845 (RRF59_13850) - 2813561..2813758 (+) 198 WP_003833701.1 hypothetical protein -
  RRF59_RS13850 (RRF59_13855) - 2813755..2813913 (+) 159 WP_172616063.1 hypothetical protein -
  RRF59_RS13855 (RRF59_13860) - 2813910..2814635 (+) 726 WP_134215759.1 Rad52/Rad22 family DNA repair protein -
  RRF59_RS13860 (RRF59_13865) ssb 2814636..2815097 (+) 462 WP_134215761.1 single-stranded DNA-binding protein Machinery gene
  RRF59_RS13865 (RRF59_13870) - 2815106..2815654 (+) 549 WP_134215763.1 3'-5' exonuclease -
  RRF59_RS13870 (RRF59_13875) - 2815672..2815956 (+) 285 WP_134215765.1 hypothetical protein -
  RRF59_RS13875 (RRF59_13880) - 2815949..2816500 (+) 552 WP_134215767.1 phage N-6-adenine-methyltransferase -
  RRF59_RS13880 (RRF59_13885) - 2816497..2816715 (+) 219 WP_134215769.1 hypothetical protein -
  RRF59_RS13885 (RRF59_13890) - 2816810..2816992 (+) 183 WP_126956111.1 hypothetical protein -
  RRF59_RS13890 (RRF59_13895) - 2816989..2817210 (+) 222 WP_126956109.1 TraR/DksA family transcriptional regulator -
  RRF59_RS13895 (RRF59_13900) - 2817409..2817648 (+) 240 WP_126956107.1 DUF4222 domain-containing protein -
  RRF59_RS13900 (RRF59_13905) - 2817658..2818305 (+) 648 WP_134215771.1 hypothetical protein -
  RRF59_RS13905 (RRF59_13910) - 2818409..2818645 (+) 237 WP_134215773.1 helix-turn-helix domain-containing protein -
  RRF59_RS13910 (RRF59_13915) - 2818603..2819811 (-) 1209 WP_134215775.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 153 a.a.        Molecular weight: 16972.03 Da        Isoelectric Point: 5.7776

>NTDB_id=887174 RRF59_RS13860 WP_134215761.1 2814636..2815097(+) (ssb) [Citrobacter freundii strain 202212]
MASRGVNKVILVGNLGQDPEVRYLPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGVDKYTTEVLVNVGGTMQMLGGKQAEGKPAGNSQQPQRIQQQPAQQHNEPPMDFDDDIPF

Nucleotide


Download         Length: 462 bp        

>NTDB_id=887174 RRF59_RS13860 WP_134215761.1 2814636..2815097(+) (ssb) [Citrobacter freundii strain 202212]
ATGGCAAGCAGAGGCGTAAACAAAGTGATCCTCGTCGGCAACCTCGGGCAAGACCCTGAGGTTCGCTATCTACCAAATGG
TGGCGCGGTAGCCAATATCACACTGGCAACTTCGGAATCATGGCGTGATAAAGCGACCGGTGAAATGAAAGAGCAGACCG
AATGGCACCGGGTGGTGCTGTTTGGCAAGTTGGCTGAAGTAGCCAGCGAATATCTTCGAAAAGGTTCTCAGGTGTACATC
GAAGGCCAGTTACGCACACGGAAATGGACAGACCAATCTGGTGTGGATAAGTACACCACTGAGGTGTTGGTTAACGTCGG
TGGAACCATGCAGATGCTTGGCGGGAAGCAAGCAGAAGGAAAACCAGCAGGTAACAGCCAGCAACCACAACGGATACAGC
AGCAACCGGCACAACAGCACAACGAGCCGCCTATGGATTTTGACGACGATATTCCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

67.978

100

0.791
  ssb Glaesserella parasuis strain SC1401

51.913

100

0.621
  ssb Neisseria meningitidis MC58

40.909

100

0.471
  ssb Neisseria gonorrhoeae MS11

40.909

100

0.471