Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   RQP58_RS14585 Genome accession   NZ_CP135261
Coordinates   2989829..2990326 (+) Length   165 a.a.
NCBI ID   WP_252005431.1    Uniprot ID   -
Organism   Enterobacter asburiae strain FAHZZU5722     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2950896..2997313 2989829..2990326 within 0


Gene organization within MGE regions


Location: 2950896..2997313
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RQP58_RS14295 (RQP58_14295) - 2950896..2951285 (-) 390 WP_182930892.1 S24 family peptidase -
  RQP58_RS14300 (RQP58_14300) - 2951397..2953508 (-) 2112 WP_315425449.1 SGNH/GDSL hydrolase family protein -
  RQP58_RS14305 (RQP58_14305) - 2953746..2954171 (-) 426 WP_315425450.1 tail fiber assembly protein -
  RQP58_RS14310 (RQP58_14310) - 2954175..2954972 (-) 798 WP_315425451.1 hypothetical protein -
  RQP58_RS14315 (RQP58_14315) - 2955289..2955993 (-) 705 WP_315425452.1 hypothetical protein -
  RQP58_RS14320 (RQP58_14320) - 2955995..2957413 (-) 1419 WP_315425453.1 ubiquitin-activating E1 FCCH domain-containing protein -
  RQP58_RS14325 (RQP58_14325) - 2957410..2957742 (-) 333 WP_049015553.1 hypothetical protein -
  RQP58_RS14330 (RQP58_14330) - 2957739..2958455 (-) 717 WP_315425454.1 hypothetical protein -
  RQP58_RS14335 (RQP58_14335) - 2958452..2959471 (-) 1020 WP_315425455.1 hypothetical protein -
  RQP58_RS14340 (RQP58_14340) - 2959471..2959746 (-) 276 WP_000108824.1 hypothetical protein -
  RQP58_RS14345 (RQP58_14345) - 2959743..2960468 (-) 726 WP_315425456.1 hypothetical protein -
  RQP58_RS14350 (RQP58_14350) - 2960471..2962306 (-) 1836 WP_315425457.1 lytic transglycosylase domain-containing protein -
  RQP58_RS14355 (RQP58_14355) - 2962430..2963014 (-) 585 WP_182930902.1 hypothetical protein -
  RQP58_RS14360 (RQP58_14360) - 2963017..2963454 (-) 438 WP_023327272.1 hypothetical protein -
  RQP58_RS14365 (RQP58_14365) - 2963458..2964852 (-) 1395 WP_182930903.1 hypothetical protein -
  RQP58_RS14370 (RQP58_14370) - 2964857..2965798 (-) 942 WP_182930904.1 hypothetical protein -
  RQP58_RS14375 (RQP58_14375) - 2965782..2966216 (-) 435 WP_182930905.1 hypothetical protein -
  RQP58_RS14380 (RQP58_14380) - 2966213..2966641 (-) 429 WP_315425458.1 hypothetical protein -
  RQP58_RS14385 (RQP58_14385) - 2966638..2967120 (-) 483 WP_279653054.1 hypothetical protein -
  RQP58_RS14390 (RQP58_14390) - 2967124..2967315 (-) 192 WP_315425459.1 hypothetical protein -
  RQP58_RS14395 (RQP58_14395) - 2967384..2968415 (-) 1032 WP_045407450.1 hypothetical protein -
  RQP58_RS14400 (RQP58_14400) - 2968432..2969292 (-) 861 WP_315425461.1 hypothetical protein -
  RQP58_RS14405 (RQP58_14405) - 2969308..2970924 (-) 1617 WP_315425462.1 NUDIX domain-containing protein -
  RQP58_RS14410 (RQP58_14410) - 2970937..2971761 (-) 825 WP_086538849.1 hypothetical protein -
  RQP58_RS14415 (RQP58_14415) - 2971758..2973179 (-) 1422 WP_315425463.1 anti-CBASS protein Acb1 family protein -
  RQP58_RS14420 (RQP58_14420) - 2973191..2974522 (-) 1332 WP_108090065.1 terminase large subunit domain-containing protein -
  RQP58_RS14425 (RQP58_14425) - 2974526..2975266 (-) 741 WP_315425465.1 hypothetical protein -
  RQP58_RS14430 (RQP58_14430) - 2975327..2975923 (-) 597 WP_315425466.1 hypothetical protein -
  RQP58_RS14435 (RQP58_14435) - 2976048..2976305 (-) 258 WP_315425467.1 hypothetical protein -
  RQP58_RS14440 (RQP58_14440) - 2976190..2976579 (-) 390 WP_315425468.1 DUF2570 domain-containing protein -
  RQP58_RS14445 (RQP58_14445) - 2976576..2977112 (-) 537 WP_315425469.1 lysozyme -
  RQP58_RS14450 (RQP58_14450) - 2977115..2977357 (-) 243 WP_229222358.1 phage holin -
  RQP58_RS14460 (RQP58_14460) - 2977718..2978407 (-) 690 WP_315425470.1 bacteriophage antitermination protein Q -
  RQP58_RS14465 (RQP58_14465) - 2978404..2978544 (-) 141 WP_017693180.1 YlcG family protein -
  RQP58_RS14470 (RQP58_14470) - 2978541..2979152 (-) 612 WP_315425471.1 recombination protein NinG -
  RQP58_RS14475 (RQP58_14475) - 2979145..2979315 (-) 171 WP_147186411.1 NinE family protein -
  RQP58_RS25070 - 2979315..2979896 (-) 582 WP_391527826.1 NUMOD4 domain-containing protein -
  RQP58_RS14480 (RQP58_14480) - 2979889..2980320 (-) 432 WP_315425472.1 recombination protein NinB -
  RQP58_RS14485 (RQP58_14485) - 2980534..2980818 (-) 285 WP_315425473.1 DUF4752 family protein -
  RQP58_RS14490 (RQP58_14490) - 2980818..2981453 (-) 636 WP_315425474.1 DUF551 domain-containing protein -
  RQP58_RS14495 (RQP58_14495) - 2981450..2981680 (-) 231 WP_045889112.1 hypothetical protein -
  RQP58_RS14500 (RQP58_14500) - 2981677..2982021 (-) 345 WP_315425475.1 winged helix-turn-helix transcriptional regulator -
  RQP58_RS14505 (RQP58_14505) - 2982023..2982712 (-) 690 WP_105607148.1 replication protein P -
  RQP58_RS14510 (RQP58_14510) - 2982709..2983572 (-) 864 WP_105607149.1 hypothetical protein -
  RQP58_RS14515 (RQP58_14515) - 2983572..2983976 (-) 405 WP_063452519.1 hypothetical protein -
  RQP58_RS14520 (RQP58_14520) - 2984052..2984309 (-) 258 WP_023303587.1 hypothetical protein -
  RQP58_RS14525 (RQP58_14525) - 2984315..2984536 (-) 222 WP_193139598.1 CII family transcriptional regulator -
  RQP58_RS14530 (RQP58_14530) - 2984577..2984798 (-) 222 WP_023296412.1 helix-turn-helix domain-containing protein -
  RQP58_RS14535 (RQP58_14535) - 2984897..2985529 (+) 633 WP_045269903.1 LexA family transcriptional regulator -
  RQP58_RS14540 (RQP58_14540) - 2985968..2986309 (+) 342 WP_315425477.1 hypothetical protein -
  RQP58_RS14545 (RQP58_14545) - 2986524..2987042 (+) 519 WP_315425479.1 hypothetical protein -
  RQP58_RS14550 (RQP58_14550) - 2987201..2987410 (+) 210 WP_063133514.1 hypothetical protein -
  RQP58_RS14555 (RQP58_14555) - 2987412..2987570 (+) 159 WP_047727208.1 hypothetical protein -
  RQP58_RS14560 (RQP58_14560) - 2987567..2987707 (+) 141 WP_315425480.1 host cell division inhibitory peptide Kil -
  RQP58_RS14565 (RQP58_14565) - 2987777..2988745 (+) 969 WP_315425481.1 hypothetical protein -
  RQP58_RS14570 (RQP58_14570) - 2988754..2988951 (+) 198 WP_001303341.1 hypothetical protein -
  RQP58_RS14575 (RQP58_14575) - 2988948..2989106 (+) 159 WP_222664914.1 hypothetical protein -
  RQP58_RS14580 (RQP58_14580) - 2989103..2989828 (+) 726 WP_315425482.1 Rad52/Rad22 family DNA repair protein -
  RQP58_RS14585 (RQP58_14585) ssb 2989829..2990326 (+) 498 WP_252005431.1 single-stranded DNA-binding protein SSB1 Machinery gene
  RQP58_RS14590 (RQP58_14590) - 2990573..2990725 (+) 153 WP_023306344.1 DUF1317 family protein -
  RQP58_RS14595 (RQP58_14595) - 2990722..2991381 (+) 660 WP_315425483.1 MT-A70 family methyltransferase -
  RQP58_RS14600 (RQP58_14600) - 2991378..2992343 (+) 966 WP_315425484.1 DNA cytosine methyltransferase -
  RQP58_RS14605 (RQP58_14605) - 2992637..2992855 (+) 219 WP_315425485.1 TraR/DksA family transcriptional regulator -
  RQP58_RS14610 (RQP58_14610) - 2992855..2993352 (+) 498 WP_315425486.1 class I SAM-dependent methyltransferase -
  RQP58_RS14615 (RQP58_14615) - 2993330..2993569 (+) 240 WP_315425487.1 DUF4222 domain-containing protein -
  RQP58_RS14620 (RQP58_14620) - 2993579..2993953 (+) 375 WP_182930931.1 hypothetical protein -
  RQP58_RS14625 (RQP58_14625) - 2994146..2994346 (+) 201 WP_047720557.1 hypothetical protein -
  RQP58_RS14630 (RQP58_14630) - 2994357..2994548 (+) 192 WP_028018495.1 AlpA family transcriptional regulator -
  RQP58_RS14635 (RQP58_14635) - 2994529..2995707 (-) 1179 WP_315425488.1 site-specific integrase -
  RQP58_RS14640 (RQP58_14640) sbcB 2995889..2997313 (+) 1425 WP_182930933.1 exodeoxyribonuclease I -

Sequence

Protein


Download         Length: 165 a.a.        Molecular weight: 17556.53 Da        Isoelectric Point: 5.7670

>NTDB_id=886327 RQP58_RS14585 WP_252005431.1 2989829..2990326(+) (ssb) [Enterobacter asburiae strain FAHZZU5722]
MASKGVNKVILVGNLGQDPEVRYLPSGGAVCSVTLATSESWRDKATGELKEQTEWHRVVLFGKLAEVAGEYLRKGSQVYI
EGQLRTRKWTDQAGVEKYTTEVVVNVGGTMQMLGGRQGGGAAPAGGSQTQGGNQFSGGAQSRAQQHSAPAQSNEPPMDFD
DDIPF

Nucleotide


Download         Length: 498 bp        

>NTDB_id=886327 RQP58_RS14585 WP_252005431.1 2989829..2990326(+) (ssb) [Enterobacter asburiae strain FAHZZU5722]
ATGGCTAGCAAAGGCGTAAACAAAGTGATCCTCGTCGGCAACCTCGGTCAAGACCCTGAGGTTCGTTATCTTCCGTCCGG
CGGCGCAGTATGCAGCGTGACGCTGGCGACATCGGAGTCATGGCGAGATAAAGCCACCGGCGAGCTCAAAGAGCAAACGG
AATGGCACCGCGTCGTTCTGTTCGGAAAGCTGGCTGAGGTAGCCGGGGAATACCTGCGCAAGGGCTCTCAGGTTTATATC
GAGGGTCAACTGCGCACCCGAAAATGGACAGATCAGGCTGGCGTGGAGAAGTACACCACGGAGGTAGTGGTAAACGTCGG
CGGCACAATGCAGATGCTTGGTGGCCGTCAGGGCGGTGGAGCGGCACCGGCGGGTGGCAGCCAAACGCAGGGCGGGAATC
AGTTCAGCGGCGGCGCACAGTCTCGTGCACAGCAGCACTCGGCACCCGCCCAATCTAACGAACCGCCAATGGACTTCGAC
GACGATATACCCTTTTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

67.978

100

0.733
  ssb Glaesserella parasuis strain SC1401

53.591

100

0.588
  ssb Neisseria meningitidis MC58

43.503

100

0.467
  ssb Neisseria gonorrhoeae MS11

43.503

100

0.467