Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   RQR14_RS05720 Genome accession   NZ_CP135196
Coordinates   1170554..1171006 (-) Length   150 a.a.
NCBI ID   WP_078801814.1    Uniprot ID   -
Organism   Pasteurella multocida strain 80176     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1167491..1213834 1170554..1171006 within 0


Gene organization within MGE regions


Location: 1167491..1213834
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RQR14_RS05690 - 1167491..1168480 (+) 990 WP_139617332.1 site-specific integrase -
  RQR14_RS05695 - 1168477..1168758 (-) 282 WP_047918098.1 hypothetical protein -
  RQR14_RS05700 - 1168797..1169093 (-) 297 WP_139617331.1 hypothetical protein -
  RQR14_RS05705 - 1169098..1169541 (-) 444 WP_315557833.1 pyruvate kinase -
  RQR14_RS05710 - 1169626..1169979 (-) 354 WP_315557834.1 hypothetical protein -
  RQR14_RS05715 - 1169988..1170485 (-) 498 WP_252759419.1 DUF551 domain-containing protein -
  RQR14_RS05720 ssb 1170554..1171006 (-) 453 WP_078801814.1 single-stranded DNA-binding protein Machinery gene
  RQR14_RS05725 - 1171006..1171680 (-) 675 WP_015691053.1 translocation protein TolB precursor -
  RQR14_RS05730 - 1171652..1172605 (-) 954 WP_014391451.1 recombinase RecT -
  RQR14_RS05735 - 1172607..1172894 (-) 288 WP_014391452.1 hypothetical protein -
  RQR14_RS05740 - 1172907..1173143 (-) 237 WP_078801815.1 hypothetical protein -
  RQR14_RS05745 - 1173115..1173414 (-) 300 WP_315557835.1 hypothetical protein -
  RQR14_RS05750 - 1173562..1173792 (+) 231 WP_223251317.1 hypothetical protein -
  RQR14_RS05755 - 1173853..1174539 (-) 687 WP_136690207.1 Bro-N domain-containing protein -
  RQR14_RS05760 - 1174883..1175008 (+) 126 WP_014391103.1 hypothetical protein -
  RQR14_RS05765 - 1175009..1175542 (-) 534 WP_014391102.1 hypothetical protein -
  RQR14_RS05770 - 1175630..1175893 (-) 264 WP_014391101.1 hypothetical protein -
  RQR14_RS05775 - 1175982..1176359 (-) 378 WP_014390713.1 hypothetical protein -
  RQR14_RS05780 - 1176334..1176525 (-) 192 WP_014391100.1 hypothetical protein -
  RQR14_RS05785 - 1176978..1177268 (-) 291 WP_276239969.1 hypothetical protein -
  RQR14_RS05790 - 1177575..1177775 (-) 201 WP_193628062.1 hypothetical protein -
  RQR14_RS05795 - 1178058..1178357 (+) 300 WP_078802155.1 type II toxin-antitoxin system RelE/ParE family toxin -
  RQR14_RS05800 - 1178359..1178655 (+) 297 WP_193628063.1 addiction module antidote protein -
  RQR14_RS05805 - 1178749..1179405 (-) 657 WP_193628064.1 LexA family transcriptional regulator -
  RQR14_RS05810 - 1179535..1179741 (+) 207 WP_193628065.1 helix-turn-helix transcriptional regulator -
  RQR14_RS05815 - 1179790..1180242 (+) 453 WP_102822910.1 phage regulatory CII family protein -
  RQR14_RS05820 - 1180245..1180442 (+) 198 WP_071523829.1 hypothetical protein -
  RQR14_RS05825 - 1180494..1181177 (+) 684 WP_315557836.1 phage antirepressor KilAC domain-containing protein -
  RQR14_RS05830 - 1181262..1182080 (+) 819 WP_015691057.1 hypothetical protein -
  RQR14_RS05835 - 1182077..1183441 (+) 1365 WP_015691058.1 replicative DNA helicase -
  RQR14_RS05840 - 1183438..1183977 (+) 540 WP_250011983.1 MT-A70 family methyltransferase -
  RQR14_RS05845 - 1183986..1184423 (+) 438 WP_014390726.1 DUF1367 family protein -
  RQR14_RS05850 - 1184583..1184798 (+) 216 WP_014667790.1 hypothetical protein -
  RQR14_RS05855 - 1184791..1185393 (+) 603 WP_014667791.1 recombination protein NinG -
  RQR14_RS05860 - 1185394..1185855 (+) 462 WP_014667792.1 antiterminator Q family protein -
  RQR14_RS05865 - 1185981..1186544 (-) 564 WP_014667793.1 hypothetical protein -
  RQR14_RS05870 - 1186662..1186922 (+) 261 WP_014391475.1 HP1 family phage holin -
  RQR14_RS05875 - 1186919..1187449 (+) 531 WP_014667794.1 lysozyme -
  RQR14_RS05880 - 1187422..1187745 (+) 324 WP_014667795.1 DUF2570 family protein -
  RQR14_RS05885 tnpA 1188037..1188453 (-) 417 WP_005720092.1 IS200/IS605 family transposase -
  RQR14_RS05890 - 1188500..1189636 (+) 1137 WP_064775610.1 RNA-guided endonuclease TnpB family protein -
  RQR14_RS05895 - 1189776..1190144 (-) 369 WP_005621567.1 helix-turn-helix transcriptional regulator -
  RQR14_RS05900 - 1190180..1190440 (-) 261 WP_071523520.1 type II toxin-antitoxin system RelE/ParE family toxin -
  RQR14_RS05905 - 1190731..1191207 (+) 477 WP_315557837.1 DUF1441 family protein -
  RQR14_RS05910 - 1191210..1193318 (+) 2109 WP_315557838.1 phage terminase large subunit family protein -
  RQR14_RS05915 - 1193315..1193536 (+) 222 WP_315557839.1 hypothetical protein -
  RQR14_RS05920 - 1193533..1195074 (+) 1542 WP_315557840.1 phage portal protein -
  RQR14_RS05925 - 1195007..1197016 (+) 2010 WP_315557841.1 ClpP-like prohead protease/major capsid protein fusion protein -
  RQR14_RS05930 - 1197088..1197414 (+) 327 WP_016570083.1 DUF2190 family protein -
  RQR14_RS05935 - 1197407..1197700 (+) 294 WP_014391484.1 hypothetical protein -
  RQR14_RS05940 - 1197700..1198251 (+) 552 WP_315557842.1 phage tail protein -
  RQR14_RS05945 - 1198248..1198655 (+) 408 WP_223131948.1 phage minor tail U family protein -
  RQR14_RS11865 - 1198699..1198761 (+) 63 WP_392391890.1 hypothetical protein -
  RQR14_RS05950 - 1198748..1199161 (+) 414 WP_392391891.1 phage tail tube protein -
  RQR14_RS05955 - 1199164..1199553 (+) 390 WP_071171120.1 phage minor tail protein G -
  RQR14_RS05960 - 1199574..1199876 (+) 303 WP_315557849.1 phage tail assembly protein T -
  RQR14_RS05965 - 1199863..1202016 (+) 2154 WP_315557844.1 phage tail length tape measure family protein -
  RQR14_RS05970 - 1202013..1202363 (+) 351 WP_005719622.1 phage tail protein -
  RQR14_RS05975 - 1202742..1203446 (+) 705 WP_315557845.1 phage minor tail protein L -
  RQR14_RS05980 - 1203451..1204194 (+) 744 WP_170460619.1 C40 family peptidase -
  RQR14_RS05985 - 1204137..1204757 (+) 621 WP_064964934.1 tail assembly protein -
  RQR14_RS05990 - 1204761..1209821 (+) 5061 WP_315557846.1 phage tail protein -
  RQR14_RS05995 - 1209866..1210189 (+) 324 WP_014390761.1 hypothetical protein -
  RQR14_RS06000 - 1210318..1211358 (+) 1041 WP_005720395.1 IS481 family transposase -
  RQR14_RS06005 - 1211697..1212917 (-) 1221 WP_064965051.1 hypothetical protein -
  RQR14_RS06010 - 1212969..1213289 (-) 321 WP_064965052.1 hypothetical protein -
  RQR14_RS11870 - 1213444..1213659 (-) 216 WP_081274327.1 ribbon-helix-helix protein, CopG family -
  RQR14_RS06015 - 1213634..1213834 (-) 201 WP_064965054.1 hypothetical protein -

Sequence


Protein


Download         Length: 150 a.a.        Molecular weight: 17107.99 Da        Isoelectric Point: 7.9707

>NTDB_id=886164 RQR14_RS05720 WP_078801814.1 1170554..1171006(-) (ssb) [Pasteurella multocida strain 80176]
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF

Nucleotide


Download         Length: 453 bp        

>NTDB_id=886164 RQR14_RS05720 WP_078801814.1 1170554..1171006(-) (ssb) [Pasteurella multocida strain 80176]
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACGCAGACAGAATGGC
ACTCTATCGTGTTTTATCGCCGCCAAGCAGAAATTTGTGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

60.556

100

0.727

  ssb Vibrio cholerae strain A1552

52.518

92.667

0.487

  ssb Neisseria gonorrhoeae MS11

44.526

91.333

0.407

  ssb Neisseria meningitidis MC58

44.526

91.333

0.407