Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | RQR13_RS07600 | Genome accession | NZ_CP135194 |
| Coordinates | 1582147..1582599 (-) | Length | 150 a.a. |
| NCBI ID | WP_315504288.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain 102426 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1575498..1624988 | 1582147..1582599 | within | 0 |
Gene organization within MGE regions
Location: 1575498..1624988
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RQR13_RS07550 | - | 1575498..1575707 (+) | 210 | WP_005716039.1 | cold-shock protein | - |
| RQR13_RS07555 | - | 1576250..1576447 (-) | 198 | WP_014391107.1 | AlpA family transcriptional regulator | - |
| RQR13_RS07560 | - | 1576505..1577116 (-) | 612 | WP_315504276.1 | KilA-N domain-containing protein | - |
| RQR13_RS07565 | - | 1577373..1578209 (-) | 837 | WP_265162141.1 | KilA-N domain-containing protein | - |
| RQR13_RS07570 | - | 1578302..1579099 (-) | 798 | WP_064964923.1 | hypothetical protein | - |
| RQR13_RS07575 | - | 1579204..1579560 (-) | 357 | WP_315504281.1 | hypothetical protein | - |
| RQR13_RS07580 | - | 1579569..1580066 (-) | 498 | WP_315504282.1 | DUF551 domain-containing protein | - |
| RQR13_RS07585 | - | 1580201..1580800 (-) | 600 | WP_014391447.1 | hypothetical protein | - |
| RQR13_RS07590 | - | 1580851..1581639 (-) | 789 | WP_315504286.1 | DUF2303 family protein | - |
| RQR13_RS07595 | - | 1581711..1582064 (-) | 354 | WP_016570064.1 | hypothetical protein | - |
| RQR13_RS07600 | ssb | 1582147..1582599 (-) | 453 | WP_315504288.1 | single-stranded DNA-binding protein | Machinery gene |
| RQR13_RS07605 | - | 1582599..1583273 (-) | 675 | WP_015691053.1 | translocation protein TolB precursor | - |
| RQR13_RS07610 | - | 1583245..1584198 (-) | 954 | WP_014391451.1 | recombinase RecT | - |
| RQR13_RS07615 | - | 1584200..1584487 (-) | 288 | WP_064964850.1 | hypothetical protein | - |
| RQR13_RS07620 | - | 1584500..1584736 (-) | 237 | WP_075271355.1 | hypothetical protein | - |
| RQR13_RS07625 | - | 1584708..1585007 (-) | 300 | WP_078802174.1 | hypothetical protein | - |
| RQR13_RS07630 | - | 1585155..1585385 (+) | 231 | WP_223251317.1 | hypothetical protein | - |
| RQR13_RS07635 | - | 1585494..1586318 (-) | 825 | WP_015691055.1 | NYN domain-containing protein | - |
| RQR13_RS07640 | - | 1586657..1586884 (-) | 228 | WP_315504297.1 | hypothetical protein | - |
| RQR13_RS07645 | - | 1587403..1588353 (-) | 951 | WP_099803110.1 | hypothetical protein | - |
| RQR13_RS07650 | - | 1588433..1589119 (-) | 687 | WP_315504298.1 | S24 family peptidase | - |
| RQR13_RS07655 | - | 1589247..1589456 (+) | 210 | WP_005720263.1 | helix-turn-helix transcriptional regulator | - |
| RQR13_RS07660 | - | 1589505..1589957 (+) | 453 | WP_014391466.1 | phage regulatory CII family protein | - |
| RQR13_RS07665 | - | 1590009..1590692 (+) | 684 | WP_014390721.1 | phage antirepressor KilAC domain-containing protein | - |
| RQR13_RS07670 | - | 1590777..1591595 (+) | 819 | WP_195188695.1 | DNA replication protein | - |
| RQR13_RS07675 | - | 1591592..1592956 (+) | 1365 | WP_015691058.1 | replicative DNA helicase | - |
| RQR13_RS07680 | - | 1592953..1593492 (+) | 540 | WP_315504308.1 | MT-A70 family methyltransferase | - |
| RQR13_RS07685 | - | 1593502..1593852 (+) | 351 | WP_015691060.1 | hypothetical protein | - |
| RQR13_RS07690 | - | 1593874..1594380 (+) | 507 | WP_250011982.1 | DUF1367 family protein | - |
| RQR13_RS07695 | - | 1594540..1594755 (+) | 216 | WP_014667790.1 | hypothetical protein | - |
| RQR13_RS07700 | - | 1594748..1595350 (+) | 603 | WP_315504313.1 | recombination protein NinG | - |
| RQR13_RS07705 | - | 1595350..1595715 (+) | 366 | WP_014390729.1 | antiterminator Q family protein | - |
| RQR13_RS07710 | - | 1595791..1596366 (+) | 576 | WP_014390730.1 | hypothetical protein | - |
| RQR13_RS07715 | - | 1596837..1597454 (+) | 618 | WP_315504316.1 | KilA-N domain-containing protein | - |
| RQR13_RS07720 | - | 1597529..1597768 (+) | 240 | WP_078819661.1 | hypothetical protein | - |
| RQR13_RS07725 | - | 1597888..1598253 (+) | 366 | WP_016533461.1 | phage holin, lambda family | - |
| RQR13_RS07730 | - | 1598225..1598809 (+) | 585 | WP_078819662.1 | glycoside hydrolase family 19 protein | - |
| RQR13_RS07735 | - | 1598812..1599135 (+) | 324 | WP_016569983.1 | DUF2570 family protein | - |
| RQR13_RS07740 | - | 1599356..1599790 (-) | 435 | WP_014390736.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| RQR13_RS07745 | - | 1599819..1600001 (-) | 183 | WP_016533497.1 | type II toxin-antitoxin system HicA family toxin | - |
| RQR13_RS07750 | - | 1600084..1600581 (+) | 498 | WP_014390737.1 | terminase | - |
| RQR13_RS07755 | - | 1600565..1601791 (+) | 1227 | WP_064964907.1 | PBSX family phage terminase large subunit | - |
| RQR13_RS07760 | - | 1601806..1603251 (+) | 1446 | WP_014390739.1 | anti-CBASS protein Acb1 family protein | - |
| RQR13_RS07765 | - | 1603205..1604176 (+) | 972 | WP_014390740.1 | phage minor head protein | - |
| RQR13_RS07770 | - | 1604191..1605537 (+) | 1347 | WP_014390741.1 | DUF2213 domain-containing protein | - |
| RQR13_RS07775 | - | 1605537..1605971 (+) | 435 | WP_014390742.1 | hypothetical protein | - |
| RQR13_RS07780 | - | 1605983..1606981 (+) | 999 | WP_014390743.1 | major capsid protein | - |
| RQR13_RS07785 | - | 1606992..1607432 (+) | 441 | WP_230397178.1 | hypothetical protein | - |
| RQR13_RS07790 | - | 1607413..1607781 (+) | 369 | WP_014390745.1 | hypothetical protein | - |
| RQR13_RS07795 | - | 1607784..1608128 (+) | 345 | WP_014390746.1 | hypothetical protein | - |
| RQR13_RS07800 | - | 1608133..1608504 (+) | 372 | WP_014390747.1 | hypothetical protein | - |
| RQR13_RS07805 | - | 1608501..1608872 (+) | 372 | WP_014390748.1 | hypothetical protein | - |
| RQR13_RS07810 | - | 1608884..1609366 (+) | 483 | WP_014390749.1 | phage tail tube protein | - |
| RQR13_RS07815 | - | 1609420..1610091 (+) | 672 | WP_014390750.1 | DUF6246 family protein | - |
| RQR13_RS07820 | - | 1610168..1610524 (+) | 357 | WP_014390751.1 | TM2 domain-containing protein | - |
| RQR13_RS07825 | - | 1610600..1611418 (-) | 819 | WP_014390752.1 | hypothetical protein | - |
| RQR13_RS07830 | - | 1611757..1612581 (+) | 825 | WP_014390754.1 | phage antirepressor N-terminal domain-containing protein | - |
| RQR13_RS07835 | - | 1612633..1615077 (+) | 2445 | WP_014390755.1 | phage tail length tape measure family protein | - |
| RQR13_RS07840 | - | 1615080..1615409 (+) | 330 | WP_014390756.1 | phage tail protein | - |
| RQR13_RS07845 | - | 1615428..1616078 (+) | 651 | WP_315504340.1 | phage minor tail protein L | - |
| RQR13_RS07850 | - | 1616080..1616793 (+) | 714 | WP_079157834.1 | C40 family peptidase | - |
| RQR13_RS07855 | - | 1616726..1617451 (+) | 726 | WP_099803048.1 | tail assembly protein | - |
| RQR13_RS07860 | - | 1617458..1621105 (+) | 3648 | WP_170353927.1 | host specificity protein J | - |
| RQR13_RS07865 | - | 1621119..1622876 (+) | 1758 | WP_240963817.1 | tail fiber protein | - |
| RQR13_RS07870 | - | 1622878..1623468 (+) | 591 | WP_153939825.1 | DUF4376 domain-containing protein | - |
| RQR13_RS07880 | - | 1623741..1624988 (-) | 1248 | WP_079157839.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 17114.95 Da Isoelectric Point: 5.9314
>NTDB_id=886143 RQR13_RS07600 WP_315504288.1 1582147..1582599(-) (ssb) [Pasteurella multocida strain 102426]
MAGVNKVIIVGNLGNDPEIRTMPNGDAVANISVATSESWIDKNTNERREITEWHRIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQADNFEEDNIPF
MAGVNKVIIVGNLGNDPEIRTMPNGDAVANISVATSESWIDKNTNERREITEWHRIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQADNFEEDNIPF
Nucleotide
Download Length: 453 bp
>NTDB_id=886143 RQR13_RS07600 WP_315504288.1 1582147..1582599(-) (ssb) [Pasteurella multocida strain 102426]
ATGGCTGGAGTCAATAAAGTAATCATTGTGGGCAATTTAGGAAATGATCCTGAAATTCGCACAATGCCAAATGGCGACGC
TGTGGCGAATATTAGCGTTGCGACAAGCGAAAGCTGGATTGATAAAAATACTAACGAACGCCGTGAAATCACAGAATGGC
ATCGTATCGTGTTCTATCGTCGCCAAGCTGAAATTTGCGGGCAGTATCTGAAAAAAGGCTCTAAAGTTTACGTAGAGGGC
AAACTCCGAACACGTAAATGGCAAGACCAAAATGGTCAAGACCGCTACACTACTGAAATTCAAGGTGATGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCAGATAACTTTGAAGAGGATAATATCCCATTCTGA
ATGGCTGGAGTCAATAAAGTAATCATTGTGGGCAATTTAGGAAATGATCCTGAAATTCGCACAATGCCAAATGGCGACGC
TGTGGCGAATATTAGCGTTGCGACAAGCGAAAGCTGGATTGATAAAAATACTAACGAACGCCGTGAAATCACAGAATGGC
ATCGTATCGTGTTCTATCGTCGCCAAGCTGAAATTTGCGGGCAGTATCTGAAAAAAGGCTCTAAAGTTTACGTAGAGGGC
AAACTCCGAACACGTAAATGGCAAGACCAAAATGGTCAAGACCGCTACACTACTGAAATTCAAGGTGATGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCAGATAACTTTGAAGAGGATAATATCCCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
65.193 |
100 |
0.787 |
| ssb | Vibrio cholerae strain A1552 |
55.396 |
92.667 |
0.513 |
| ssb | Neisseria gonorrhoeae MS11 |
47.445 |
91.333 |
0.433 |
| ssb | Neisseria meningitidis MC58 |
47.445 |
91.333 |
0.433 |