Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   RQR13_RS04320 Genome accession   NZ_CP135194
Coordinates   860238..860738 (-) Length   166 a.a.
NCBI ID   WP_005725039.1    Uniprot ID   A0A379BD60
Organism   Pasteurella multocida strain 102426     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 813909..867597 860238..860738 within 0


Gene organization within MGE regions


Location: 813909..867597
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RQR13_RS03990 - 813909..814328 (-) 420 WP_005719426.1 DUF417 family protein -
  RQR13_RS03995 - 814667..815482 (-) 816 WP_240961993.1 tape measure protein -
  RQR13_RS04000 - 815500..815826 (-) 327 WP_015691082.1 phage tail protein -
  RQR13_RS04005 - 815834..816163 (-) 330 WP_015691081.1 hypothetical protein -
  RQR13_RS04010 - 816172..816576 (-) 405 WP_005756587.1 hypothetical protein -
  RQR13_RS04015 - 816650..817666 (-) 1017 WP_064964909.1 phage tail tube protein -
  RQR13_RS04020 - 817679..818074 (-) 396 WP_064964910.1 phage tail terminator-like protein -
  RQR13_RS04025 - 818074..818475 (-) 402 WP_064964911.1 HK97 gp10 family phage protein -
  RQR13_RS04030 - 818477..818851 (-) 375 WP_064964912.1 hypothetical protein -
  RQR13_RS04035 - 818853..819320 (-) 468 WP_064964913.1 DnaT-like ssDNA-binding protein -
  RQR13_RS04040 - 819337..819573 (-) 237 WP_064964914.1 HeH/LEM domain-containing protein -
  RQR13_RS04045 - 819630..820787 (-) 1158 WP_075271385.1 P22 phage major capsid protein family protein -
  RQR13_RS04050 - 820805..821590 (-) 786 WP_079157868.1 hypothetical protein -
  RQR13_RS04055 - 821766..822164 (-) 399 WP_079157867.1 hypothetical protein -
  RQR13_RS04060 - 822201..822635 (-) 435 WP_064965033.1 HD domain-containing protein -
  RQR13_RS04065 - 822610..822828 (-) 219 WP_079157866.1 hypothetical protein -
  RQR13_RS04070 - 822831..824432 (-) 1602 WP_079157879.1 minor capsid protein -
  RQR13_RS04075 - 824422..825825 (-) 1404 WP_064964917.1 DUF4055 domain-containing protein -
  RQR13_RS04080 - 825835..827070 (-) 1236 WP_064964918.1 PBSX family phage terminase large subunit -
  RQR13_RS04085 - 827054..827551 (-) 498 WP_014390737.1 terminase -
  RQR13_RS04090 - 827634..827816 (+) 183 WP_016533497.1 type II toxin-antitoxin system HicA family toxin -
  RQR13_RS04095 - 827845..828279 (+) 435 WP_046338366.1 type II toxin-antitoxin system HicB family antitoxin -
  RQR13_RS04100 - 828501..828824 (-) 324 WP_079157976.1 DUF2570 family protein -
  RQR13_RS04105 - 828797..829327 (-) 531 WP_069915984.1 lysozyme -
  RQR13_RS04110 - 829324..829581 (-) 258 WP_099821837.1 phage holin -
  RQR13_RS04115 - 829959..830174 (+) 216 WP_015691066.1 hypothetical protein -
  RQR13_RS04120 - 830383..831000 (-) 618 WP_014390731.1 KilA-N domain-containing protein -
  RQR13_RS04125 - 831288..831863 (-) 576 WP_014390730.1 hypothetical protein -
  RQR13_RS04130 - 831939..832304 (-) 366 WP_014390729.1 antiterminator Q family protein -
  RQR13_RS04135 - 832304..832906 (-) 603 WP_315504313.1 recombination protein NinG -
  RQR13_RS04140 - 832899..833114 (-) 216 WP_252759495.1 hypothetical protein -
  RQR13_RS04145 - 833188..833613 (-) 426 WP_250023941.1 recombination protein NinB -
  RQR13_RS04150 - 833603..834139 (-) 537 WP_315505467.1 phage N-6-adenine-methyltransferase -
  RQR13_RS04155 - 834143..835582 (-) 1440 WP_315505469.1 DnaB-like helicase C-terminal domain-containing protein -
  RQR13_RS04160 - 835582..836421 (-) 840 WP_071523827.1 DNA replication protein -
  RQR13_RS04165 - 836506..837189 (-) 684 WP_014390721.1 phage antirepressor KilAC domain-containing protein -
  RQR13_RS04170 - 837241..837693 (-) 453 WP_014391466.1 phage regulatory CII family protein -
  RQR13_RS04175 - 837742..837951 (-) 210 WP_005720263.1 helix-turn-helix transcriptional regulator -
  RQR13_RS04180 - 838079..838765 (+) 687 WP_014391464.1 XRE family transcriptional regulator -
  RQR13_RS04185 - 838841..839578 (+) 738 WP_014390717.1 HipA family kinase -
  RQR13_RS04190 - 839575..840399 (+) 825 WP_014390716.1 DUF3037 domain-containing protein -
  RQR13_RS04195 - 840907..841134 (+) 228 WP_014390715.1 hypothetical protein -
  RQR13_RS04200 - 841473..842297 (+) 825 WP_015691055.1 NYN domain-containing protein -
  RQR13_RS04205 - 842406..842636 (-) 231 WP_223251317.1 hypothetical protein -
  RQR13_RS04210 - 842784..843083 (+) 300 WP_014390709.1 hypothetical protein -
  RQR13_RS04215 - 843055..843291 (+) 237 WP_014667786.1 hypothetical protein -
  RQR13_RS04220 - 843305..843466 (+) 162 WP_014390707.1 hypothetical protein -
  RQR13_RS04225 - 843639..844289 (+) 651 WP_014390705.1 ribonuclease H-like domain-containing protein -
  RQR13_RS04230 - 844332..845033 (+) 702 WP_014390704.1 ERF family protein -
  RQR13_RS04235 ssb 845044..845496 (+) 453 WP_014390703.1 single-stranded DNA-binding protein Machinery gene
  RQR13_RS04240 - 845563..846084 (+) 522 WP_014390702.1 MazG-like family protein -
  RQR13_RS04245 - 846084..846395 (+) 312 WP_014390701.1 DUF6378 domain-containing protein -
  RQR13_RS04250 - 846474..846857 (+) 384 WP_014390700.1 hypothetical protein -
  RQR13_RS04255 rdgC 846860..847762 (+) 903 WP_014390699.1 recombination-associated protein RdgC -
  RQR13_RS04260 - 847803..848291 (+) 489 WP_014390698.1 DUF551 domain-containing protein -
  RQR13_RS04265 - 848300..848656 (+) 357 WP_015691049.1 hypothetical protein -
  RQR13_RS04270 - 848760..849668 (+) 909 WP_015691048.1 P63C domain-containing protein -
  RQR13_RS04275 - 849913..850134 (+) 222 WP_064775645.1 hypothetical protein -
  RQR13_RS04280 - 850145..850867 (+) 723 WP_064964854.1 phage antirepressor KilAC domain-containing protein -
  RQR13_RS04285 - 851051..851353 (+) 303 WP_075271365.1 helix-turn-helix domain-containing protein -
  RQR13_RS04290 - 851257..852312 (+) 1056 WP_014391441.1 site-specific integrase -
  RQR13_RS04305 folD 852687..853541 (+) 855 WP_014391440.1 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD -
  RQR13_RS04310 - 853557..853937 (+) 381 WP_014391439.1 hypothetical protein -
  RQR13_RS04315 - 854719..858888 (-) 4170 WP_099821844.1 NACHT domain-containing NTPase -
  RQR13_RS04320 ssb 860238..860738 (-) 501 WP_005725039.1 single-stranded DNA-binding protein Machinery gene
  RQR13_RS04325 uvrA 860910..863741 (+) 2832 WP_014391437.1 excinuclease ABC subunit UvrA -
  RQR13_RS04330 sodC 863812..864372 (+) 561 WP_014391436.1 superoxide dismutase family protein -
  RQR13_RS04335 rlmB 864458..865195 (-) 738 WP_005725044.1 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB -
  RQR13_RS04340 rnr 865270..867597 (-) 2328 WP_014391435.1 ribonuclease R -

Sequence


Protein


Download         Length: 166 a.a.        Molecular weight: 18657.68 Da        Isoelectric Point: 5.3353

>NTDB_id=886135 RQR13_RS04320 WP_005725039.1 860238..860738(-) (ssb) [Pasteurella multocida strain 102426]
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTAAPQYNAPTGGYGAQPSRPATKPAPQNEPPMDMGFE
EDNIPF

Nucleotide


Download         Length: 501 bp        

>NTDB_id=886135 RQR13_RS04320 WP_005725039.1 860238..860738(-) (ssb) [Pasteurella multocida strain 102426]
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGGAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGA
CGCCTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGATCGCTACACTACCGAGATCCAAGGCGACGTGTTGCAAAT
GCTCGACAGCCGTAACGAACGTCAACAAACCGGCGGCTACGCCCCACAAACCGCTGCGCCACAATATAATGCCCCAACAG
GTGGCTACGGCGCACAACCTTCTCGTCCAGCGACAAAACCCGCTCCACAAAACGAACCTCCAATGGACATGGGCTTTGAG
GAAGATAATATTCCGTTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A379BD60

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

69.231

100

0.759

  ssb Vibrio cholerae strain A1552

53.591

100

0.584

  ssb Neisseria meningitidis MC58

44.068

100

0.47

  ssb Neisseria gonorrhoeae MS11

44.068

100

0.47