Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   RQT66_RS07705 Genome accession   NZ_CP135192
Coordinates   1593400..1593852 (-) Length   150 a.a.
NCBI ID   WP_014667785.1    Uniprot ID   -
Organism   Pasteurella multocida strain 190055     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1587347..1638589 1593400..1593852 within 0


Gene organization within MGE regions


Location: 1587347..1638589
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RQT66_RS07655 - 1587347..1587556 (+) 210 WP_005716039.1 cold-shock protein -
  RQT66_RS07660 - 1588099..1588296 (-) 198 WP_014391107.1 AlpA family transcriptional regulator -
  RQT66_RS07665 - 1588354..1588989 (-) 636 WP_014391104.1 Bro-N domain-containing protein -
  RQT66_RS07670 - 1589228..1590136 (-) 909 WP_015691048.1 P63C domain-containing protein -
  RQT66_RS07675 - 1590240..1590596 (-) 357 WP_015691049.1 hypothetical protein -
  RQT66_RS07680 - 1590605..1591093 (-) 489 WP_014390698.1 DUF551 domain-containing protein -
  RQT66_RS07685 rdgC 1591134..1592036 (-) 903 WP_014390699.1 recombination-associated protein RdgC -
  RQT66_RS07690 - 1592039..1592422 (-) 384 WP_014390700.1 hypothetical protein -
  RQT66_RS07695 - 1592501..1592812 (-) 312 WP_014390701.1 DUF6378 domain-containing protein -
  RQT66_RS07700 - 1592812..1593333 (-) 522 WP_014390702.1 MazG-like family protein -
  RQT66_RS07705 ssb 1593400..1593852 (-) 453 WP_014667785.1 single-stranded DNA-binding protein Machinery gene
  RQT66_RS07710 - 1593863..1594564 (-) 702 WP_014390704.1 ERF family protein -
  RQT66_RS07715 - 1594607..1595257 (-) 651 WP_014390705.1 ribonuclease H-like domain-containing protein -
  RQT66_RS07720 - 1595430..1595591 (-) 162 WP_014390707.1 hypothetical protein -
  RQT66_RS07725 - 1595605..1595841 (-) 237 WP_014667786.1 hypothetical protein -
  RQT66_RS07730 - 1595813..1596112 (-) 300 WP_014390709.1 hypothetical protein -
  RQT66_RS07735 - 1596260..1596490 (+) 231 WP_223251317.1 hypothetical protein -
  RQT66_RS07740 - 1596552..1597208 (-) 657 WP_014390711.1 Bro-N domain-containing protein -
  RQT66_RS07745 - 1597493..1598329 (-) 837 WP_014390712.1 KilA-N domain-containing protein -
  RQT66_RS07750 - 1598440..1598817 (-) 378 WP_014390713.1 hypothetical protein -
  RQT66_RS07755 - 1598792..1598983 (-) 192 WP_014390714.1 hypothetical protein -
  RQT66_RS07770 - 1599871..1600098 (-) 228 WP_099821843.1 hypothetical protein -
  RQT66_RS07775 - 1600556..1600870 (+) 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin -
  RQT66_RS07780 - 1600867..1601157 (+) 291 WP_078819686.1 addiction module antidote protein -
  RQT66_RS07785 - 1601183..1601587 (-) 405 WP_146024473.1 hypothetical protein -
  RQT66_RS07790 - 1601617..1603461 (-) 1845 WP_170356870.1 DEAD/DEAH box helicase -
  RQT66_RS07795 - 1603672..1604349 (-) 678 WP_014390718.1 XRE family transcriptional regulator -
  RQT66_RS07800 - 1604473..1604670 (+) 198 WP_014390719.1 helix-turn-helix domain-containing protein -
  RQT66_RS07805 - 1604720..1605172 (+) 453 WP_014390720.1 phage regulatory CII family protein -
  RQT66_RS07810 - 1605224..1605906 (+) 683 Protein_1513 phage antirepressor KilAC domain-containing protein -
  RQT66_RS07815 - 1605903..1606256 (+) 354 WP_014390722.1 HNH endonuclease -
  RQT66_RS07820 - 1606258..1607157 (+) 900 WP_014390723.1 hypothetical protein -
  RQT66_RS07825 - 1607157..1607852 (+) 696 WP_014390724.1 replication protein P -
  RQT66_RS07830 - 1607845..1608375 (+) 531 WP_014390725.1 MT-A70 family methyltransferase -
  RQT66_RS07835 - 1608384..1608821 (+) 438 WP_014390726.1 DUF1367 family protein -
  RQT66_RS07840 - 1608981..1609196 (+) 216 WP_014390727.1 hypothetical protein -
  RQT66_RS07845 - 1609189..1609791 (+) 603 WP_014390728.1 recombination protein NinG -
  RQT66_RS07850 - 1609791..1610156 (+) 366 WP_014390729.1 antiterminator Q family protein -
  RQT66_RS07855 - 1610232..1610807 (+) 576 WP_014390730.1 hypothetical protein -
  RQT66_RS07860 - 1611095..1611712 (+) 618 WP_014390731.1 KilA-N domain-containing protein -
  RQT66_RS07865 - 1611876..1612151 (+) 276 WP_157808540.1 hypothetical protein -
  RQT66_RS07870 - 1612514..1612771 (+) 258 WP_079157977.1 phage holin -
  RQT66_RS07875 - 1612768..1613298 (+) 531 WP_069915984.1 lysozyme -
  RQT66_RS07880 - 1613271..1613594 (+) 324 WP_079157976.1 DUF2570 family protein -
  RQT66_RS07885 - 1613816..1614250 (-) 435 WP_046338366.1 type II toxin-antitoxin system HicB family antitoxin -
  RQT66_RS07890 - 1614279..1614461 (-) 183 WP_016533497.1 type II toxin-antitoxin system HicA family toxin -
  RQT66_RS07895 - 1614544..1615041 (+) 498 WP_014390737.1 terminase -
  RQT66_RS07900 - 1615025..1616251 (+) 1227 WP_371694922.1 PBSX family phage terminase large subunit -
  RQT66_RS07905 - 1616266..1617711 (+) 1446 WP_079157826.1 anti-CBASS protein Acb1 family protein -
  RQT66_RS07910 - 1617665..1618636 (+) 972 WP_079157827.1 phage minor head protein -
  RQT66_RS07915 - 1618651..1619997 (+) 1347 WP_079157828.1 DUF2213 domain-containing protein -
  RQT66_RS07920 - 1619997..1620431 (+) 435 WP_014390742.1 hypothetical protein -
  RQT66_RS07925 - 1620443..1621441 (+) 999 WP_371694924.1 major capsid protein -
  RQT66_RS07930 - 1621452..1621838 (+) 387 WP_371694926.1 hypothetical protein -
  RQT66_RS07935 - 1621819..1622187 (+) 369 WP_078819881.1 hypothetical protein -
  RQT66_RS07940 - 1622190..1622534 (+) 345 WP_014390746.1 hypothetical protein -
  RQT66_RS07945 - 1622539..1622910 (+) 372 WP_079157831.1 hypothetical protein -
  RQT66_RS07950 - 1622907..1623278 (+) 372 WP_016533319.1 hypothetical protein -
  RQT66_RS07955 - 1623290..1623772 (+) 483 WP_079157832.1 phage tail tube protein -
  RQT66_RS07960 - 1623826..1624497 (+) 672 WP_079157833.1 DUF6246 family protein -
  RQT66_RS07965 - 1624535..1625189 (-) 655 Protein_1544 IS1595 family transposase -
  RQT66_RS07970 - 1625251..1625715 (+) 465 WP_078819890.1 hypothetical protein -
  RQT66_RS07975 - 1625783..1626178 (+) 396 WP_078819889.1 hypothetical protein -
  RQT66_RS07980 - 1626237..1628681 (+) 2445 WP_079157852.1 phage tail length tape measure family protein -
  RQT66_RS07985 - 1628684..1629013 (+) 330 WP_078819811.1 phage tail protein -
  RQT66_RS07990 - 1629032..1629682 (+) 651 WP_078819812.1 phage minor tail protein L -
  RQT66_RS07995 - 1629684..1630397 (+) 714 WP_079157834.1 C40 family peptidase -
  RQT66_RS08000 - 1630330..1631049 (+) 720 WP_143932431.1 tail assembly protein -
  RQT66_RS08005 - 1631053..1634700 (+) 3648 WP_079157835.1 host specificity protein J -
  RQT66_RS08010 - 1634712..1636469 (+) 1758 WP_170352179.1 pyocin knob domain-containing protein -
  RQT66_RS08015 - 1636479..1637069 (+) 591 WP_079157837.1 DUF4376 domain-containing protein -
  RQT66_RS08020 - 1637056..1637316 (+) 261 WP_079157838.1 DNA helicase UvrD -
  RQT66_RS08025 - 1637342..1638589 (-) 1248 WP_079157839.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 150 a.a.        Molecular weight: 17092.00 Da        Isoelectric Point: 7.9707

>NTDB_id=886120 RQT66_RS07705 WP_014667785.1 1593400..1593852(-) (ssb) [Pasteurella multocida strain 190055]
MVGVNKVIIVGNLGNDPEIRTMPNGDPVAKISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF

Nucleotide


Download         Length: 453 bp        

>NTDB_id=886120 RQT66_RS07705 WP_014667785.1 1593400..1593852(-) (ssb) [Pasteurella multocida strain 190055]
ATGGTAGGTGTTAATAAAGTAATTATCGTGGGAAATTTGGGAAACGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTTGCAAAAATCAGCGTCGCAACCAGTGAAAGCTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

61.667

100

0.74
  ssb Vibrio cholerae strain A1552

53.957

92.667

0.5
  ssb Neisseria gonorrhoeae MS11

46.043

92.667

0.427
  ssb Neisseria meningitidis MC58

46.043

92.667

0.427