Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   RQT66_RS04410 Genome accession   NZ_CP135192
Coordinates   871963..872463 (-) Length   166 a.a.
NCBI ID   WP_005725039.1    Uniprot ID   A0A379BD60
Organism   Pasteurella multocida strain 190055     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 818172..879322 871963..872463 within 0


Gene organization within MGE regions


Location: 818172..879322
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RQT66_RS04015 - 818172..819056 (+) 885 WP_005755551.1 septal ring lytic transglycosylase RlpA family protein -
  RQT66_RS04020 - 819083..820267 (+) 1185 WP_005752389.1 serine hydrolase -
  RQT66_RS04025 ybeD 820370..820666 (+) 297 WP_005719420.1 DUF493 family protein YbeD -
  RQT66_RS04030 lipB 820673..821329 (+) 657 WP_014391496.1 lipoyl(octanoyl) transferase LipB -
  RQT66_RS04035 lipA 821394..822356 (+) 963 WP_005719422.1 lipoyl synthase -
  RQT66_RS04040 - 822434..822853 (-) 420 WP_371694974.1 DUF417 family protein -
  RQT66_RS04045 - 823192..824007 (-) 816 WP_240961993.1 tape measure protein -
  RQT66_RS04050 - 824025..824351 (-) 327 WP_015691082.1 phage tail protein -
  RQT66_RS04055 - 824359..824688 (-) 330 WP_015691081.1 hypothetical protein -
  RQT66_RS04060 - 824697..825101 (-) 405 WP_005756587.1 hypothetical protein -
  RQT66_RS04065 - 825175..826191 (-) 1017 WP_064964909.1 phage tail tube protein -
  RQT66_RS04070 - 826204..826599 (-) 396 WP_064964910.1 phage tail terminator-like protein -
  RQT66_RS04075 - 826599..827000 (-) 402 WP_064964911.1 HK97 gp10 family phage protein -
  RQT66_RS04080 - 827002..827376 (-) 375 WP_064964912.1 hypothetical protein -
  RQT66_RS04085 - 827378..827845 (-) 468 WP_064964913.1 DnaT-like ssDNA-binding protein -
  RQT66_RS04090 - 827862..828098 (-) 237 WP_064964914.1 HeH/LEM domain-containing protein -
  RQT66_RS04095 - 828155..829312 (-) 1158 WP_075271385.1 P22 phage major capsid protein family protein -
  RQT66_RS04100 - 829330..830115 (-) 786 WP_079157868.1 hypothetical protein -
  RQT66_RS04105 - 830291..830689 (-) 399 WP_079157867.1 hypothetical protein -
  RQT66_RS04110 - 830726..831160 (-) 435 WP_064965033.1 HD domain-containing protein -
  RQT66_RS04115 - 831135..831353 (-) 219 WP_079157866.1 hypothetical protein -
  RQT66_RS04120 - 831356..832969 (-) 1614 WP_223251319.1 minor capsid protein -
  RQT66_RS04125 - 832947..834350 (-) 1404 WP_064964917.1 DUF4055 domain-containing protein -
  RQT66_RS04130 - 834360..835595 (-) 1236 WP_064964918.1 PBSX family phage terminase large subunit -
  RQT66_RS04135 - 835579..836076 (-) 498 WP_014390737.1 terminase -
  RQT66_RS04140 - 836159..836341 (+) 183 WP_016533497.1 type II toxin-antitoxin system HicA family toxin -
  RQT66_RS04145 - 836370..836804 (+) 435 WP_046338366.1 type II toxin-antitoxin system HicB family antitoxin -
  RQT66_RS04150 - 837026..837349 (-) 324 WP_079157976.1 DUF2570 family protein -
  RQT66_RS04155 - 837322..837852 (-) 531 WP_069915984.1 lysozyme -
  RQT66_RS04160 - 837849..838106 (-) 258 WP_079157977.1 phage holin -
  RQT66_RS04165 - 838469..838744 (-) 276 WP_157808540.1 hypothetical protein -
  RQT66_RS04170 - 838908..839525 (-) 618 WP_014390731.1 KilA-N domain-containing protein -
  RQT66_RS04175 - 839813..840388 (-) 576 WP_014390730.1 hypothetical protein -
  RQT66_RS04180 - 840464..840829 (-) 366 WP_014390729.1 antiterminator Q family protein -
  RQT66_RS04185 - 840829..841431 (-) 603 WP_014390728.1 recombination protein NinG -
  RQT66_RS04190 - 841424..841639 (-) 216 WP_014390727.1 hypothetical protein -
  RQT66_RS04195 - 841799..842236 (-) 438 WP_014390726.1 DUF1367 family protein -
  RQT66_RS04200 - 842245..842775 (-) 531 WP_014390725.1 MT-A70 family methyltransferase -
  RQT66_RS04205 - 842768..843463 (-) 696 WP_014390724.1 replication protein P -
  RQT66_RS04210 - 843463..844362 (-) 900 WP_014390723.1 hypothetical protein -
  RQT66_RS04215 - 844364..844717 (-) 354 WP_014390722.1 HNH endonuclease -
  RQT66_RS04220 - 844714..845397 (-) 684 WP_014390721.1 phage antirepressor KilAC domain-containing protein -
  RQT66_RS04225 - 845449..845901 (-) 453 WP_014390720.1 phage regulatory CII family protein -
  RQT66_RS04230 - 845951..846148 (-) 198 WP_014390719.1 helix-turn-helix domain-containing protein -
  RQT66_RS04235 - 846272..846949 (+) 678 WP_014390718.1 XRE family transcriptional regulator -
  RQT66_RS04240 - 847160..849004 (+) 1845 WP_170356870.1 DEAD/DEAH box helicase -
  RQT66_RS04245 - 849034..849438 (+) 405 WP_146024473.1 hypothetical protein -
  RQT66_RS04250 - 849464..849754 (-) 291 WP_078819686.1 addiction module antidote protein -
  RQT66_RS04255 - 849751..850065 (-) 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin -
  RQT66_RS04260 - 850523..850750 (+) 228 WP_099821843.1 hypothetical protein -
  RQT66_RS04275 - 851638..851829 (+) 192 WP_014390714.1 hypothetical protein -
  RQT66_RS04280 - 851804..852181 (+) 378 WP_014390713.1 hypothetical protein -
  RQT66_RS04285 - 852292..853128 (+) 837 WP_014390712.1 KilA-N domain-containing protein -
  RQT66_RS04290 - 853413..854069 (+) 657 WP_014390711.1 Bro-N domain-containing protein -
  RQT66_RS04295 - 854131..854361 (-) 231 WP_223251317.1 hypothetical protein -
  RQT66_RS04300 - 854509..854808 (+) 300 WP_014390709.1 hypothetical protein -
  RQT66_RS04305 - 854780..855016 (+) 237 WP_014667786.1 hypothetical protein -
  RQT66_RS04310 - 855030..855191 (+) 162 WP_014390707.1 hypothetical protein -
  RQT66_RS04315 - 855364..856014 (+) 651 WP_014390705.1 ribonuclease H-like domain-containing protein -
  RQT66_RS04320 - 856057..856758 (+) 702 WP_014390704.1 ERF family protein -
  RQT66_RS04325 ssb 856769..857221 (+) 453 WP_014667785.1 single-stranded DNA-binding protein Machinery gene
  RQT66_RS04330 - 857288..857809 (+) 522 WP_014390702.1 MazG-like family protein -
  RQT66_RS04335 - 857809..858120 (+) 312 WP_014390701.1 DUF6378 domain-containing protein -
  RQT66_RS04340 - 858199..858582 (+) 384 WP_014390700.1 hypothetical protein -
  RQT66_RS04345 rdgC 858585..859487 (+) 903 WP_014390699.1 recombination-associated protein RdgC -
  RQT66_RS04350 - 859528..860016 (+) 489 WP_014390698.1 DUF551 domain-containing protein -
  RQT66_RS04355 - 860025..860381 (+) 357 WP_015691049.1 hypothetical protein -
  RQT66_RS04360 - 860485..861393 (+) 909 WP_015691048.1 P63C domain-containing protein -
  RQT66_RS04365 - 861638..861859 (+) 222 WP_064775645.1 hypothetical protein -
  RQT66_RS04370 - 861870..862592 (+) 723 WP_064964854.1 phage antirepressor KilAC domain-containing protein -
  RQT66_RS04375 - 862776..863078 (+) 303 WP_075271365.1 helix-turn-helix domain-containing protein -
  RQT66_RS04380 - 862982..864037 (+) 1056 WP_014391441.1 site-specific integrase -
  RQT66_RS04395 folD 864412..865266 (+) 855 WP_014391440.1 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD -
  RQT66_RS04400 - 865282..865662 (+) 381 WP_014391439.1 hypothetical protein -
  RQT66_RS04405 - 866444..870613 (-) 4170 WP_170356796.1 NACHT domain-containing NTPase -
  RQT66_RS04410 ssb 871963..872463 (-) 501 WP_005725039.1 single-stranded DNA-binding protein Machinery gene
  RQT66_RS04415 uvrA 872635..875466 (+) 2832 WP_014391437.1 excinuclease ABC subunit UvrA -
  RQT66_RS04420 sodC 875537..876097 (+) 561 WP_014391436.1 superoxide dismutase family protein -
  RQT66_RS04425 rlmB 876183..876920 (-) 738 WP_005725044.1 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB -
  RQT66_RS04430 rnr 876995..879322 (-) 2328 WP_014391435.1 ribonuclease R -

Sequence

Protein


Download         Length: 166 a.a.        Molecular weight: 18657.68 Da        Isoelectric Point: 5.3353

>NTDB_id=886112 RQT66_RS04410 WP_005725039.1 871963..872463(-) (ssb) [Pasteurella multocida strain 190055]
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTAAPQYNAPTGGYGAQPSRPATKPAPQNEPPMDMGFE
EDNIPF

Nucleotide


Download         Length: 501 bp        

>NTDB_id=886112 RQT66_RS04410 WP_005725039.1 871963..872463(-) (ssb) [Pasteurella multocida strain 190055]
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGGAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGA
CGCCTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGATCGCTACACTACCGAGATCCAAGGCGACGTGTTGCAAAT
GCTCGACAGCCGTAACGAACGTCAACAAACCGGCGGCTACGCCCCACAAACCGCTGCGCCACAATATAATGCCCCAACAG
GTGGCTACGGCGCACAACCTTCTCGTCCAGCGACAAAACCCGCTCCACAAAACGAACCTCCAATGGACATGGGCTTTGAG
GAAGATAATATTCCGTTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A379BD60

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

69.231

100

0.759
  ssb Vibrio cholerae strain A1552

53.591

100

0.584
  ssb Neisseria meningitidis MC58

44.068

100

0.47
  ssb Neisseria gonorrhoeae MS11

44.068

100

0.47