Detailed information NTG0885020

Bioinformatically predicted

Overview

• Name: comGF/cglF
• Type: Machinery gene
• Locus tag: RMP64_RS00810
• Genome accession: NZ_CP135093
• Coordinates: 128949..129383 (+)
• Length: 144 a.a.
• NCBI ID: WP_029750050.1
• Uniprot ID: -
• Organism: Streptococcus suis strain 1652329
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 123949..134383

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RMP64_RS00775 (RMP64_00775)	-	124694..125059 (+)	366	WP_002936568.1	DUF1033 family protein	-
RMP64_RS00780 (RMP64_00780)	-	125094..126044 (-)	951	WP_024394700.1	S66 peptidase family protein	-
RMP64_RS00785 (RMP64_00785)	comYA	126130..127080 (+)	951	WP_014637312.1	competence type IV pilus ATPase ComGA	Machinery gene
RMP64_RS00790 (RMP64_00790)	comYB	126992..128029 (+)	1038	WP_043032925.1	competence type IV pilus assembly protein ComGB	Machinery gene
RMP64_RS00795 (RMP64_00795)	comYC	128031..128312 (+)	282	WP_011921720.1	competence type IV pilus major pilin ComGC	Machinery gene
RMP64_RS00800 (RMP64_00800)	comGD	128293..128697 (+)	405	WP_087013850.1	competence type IV pilus minor pilin ComGD	-
RMP64_RS00805 (RMP64_00805)	comYE	128669..128962 (+)	294	WP_024394703.1	competence type IV pilus minor pilin ComGE	Machinery gene
RMP64_RS00810 (RMP64_00810)	comGF/cglF	128949..129383 (+)	435	WP_029750050.1	competence type IV pilus minor pilin ComGF	Machinery gene
RMP64_RS00815 (RMP64_00815)	comGG	129361..129771 (+)	411	WP_024394705.1	competence type IV pilus minor pilin ComGG	-
RMP64_RS00820 (RMP64_00820)	comYH	129828..130781 (+)	954	WP_024394706.1	class I SAM-dependent methyltransferase	Machinery gene
RMP64_RS00825 (RMP64_00825)	-	130831..132018 (+)	1188	WP_014637319.1	acetate kinase	-
RMP64_RS00830 (RMP64_00830)	-	132333..132884 (+)	552	WP_014636756.1	folate family ECF transporter S component	-
RMP64_RS00835 (RMP64_00835)	-	132938..134194 (+)	1257	WP_024394707.1	folylpolyglutamate synthase/dihydrofolate synthase family protein	-

Sequence

Protein

• Length: 144 a.a.
• Molecular weight: 16507.85 Da
• Isoelectric Point: 8.8193

>NTDB_id=885020 RMP64_RS00810 WP_029750050.1 128949..129383(+) (comGF/cglF) [Streptococcus suis strain 1652329]
MLKSKIPAFTLLECLVALVILSGSLLVFEGLSKLLIQEAHYQRQSVQKEWLVFSSQLRSEWDRSELVKVENGKVYVDKGG
QSLAFGKSRSDDFRKTNDRGQGYQPMLYQVDSAAISQENQLVRIDFSFKNGEERTFIYAFKEKS

Nucleotide

• Length: 435 bp

>NTDB_id=885020 RMP64_RS00810 WP_029750050.1 128949..129383(+) (comGF/cglF) [Streptococcus suis strain 1652329]
TTGTTAAAAAGTAAAATTCCCGCTTTTACTCTCCTGGAATGCTTGGTAGCCTTAGTCATCCTATCAGGAAGTCTTCTGGT
CTTTGAAGGCTTGTCAAAGTTGTTGATTCAAGAAGCACATTACCAACGTCAATCTGTCCAAAAGGAGTGGCTGGTATTTT
CTAGTCAGTTGCGGTCAGAGTGGGACCGGTCGGAATTGGTCAAGGTTGAAAATGGCAAGGTCTATGTTGATAAAGGTGGT
CAGTCGTTGGCCTTTGGTAAGTCACGATCGGATGATTTTCGGAAAACAAATGACAGGGGACAGGGCTACCAGCCCATGCT
CTATCAGGTGGACAGTGCAGCTATTTCCCAAGAAAACCAGCTGGTGCGTATCGACTTTAGCTTTAAAAACGGAGAGGAGC
GGACCTTTATCTATGCTTTTAAAGAAAAAAGTTAA

Domains

Predicted by InterproScan.

• Putative Competence protein ComGF (ComGF) (36-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF/cglF	Streptococcus pneumoniae TIGR4	56.738	97.917	0.556
comGF/cglF	Streptococcus pneumoniae Rx1	56.738	97.917	0.556
comGF/cglF	Streptococcus pneumoniae D39	56.738	97.917	0.556
comGF/cglF	Streptococcus pneumoniae R6	56.738	97.917	0.556
comGF/cglF	Streptococcus mitis NCTC 12261	57.463	93.056	0.535
comGF/cglF	Streptococcus mitis SK321	54.478	93.056	0.507
comYF	Streptococcus mutans UA140	50.694	100	0.507
comYF	Streptococcus mutans UA159	50	100	0.5
comGF	Lactococcus lactis subsp. cremoris KW2	46.099	97.917	0.451