Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   RKQ71_RS03045 Genome accession   NZ_CP134550
Coordinates   599545..599898 (-) Length   117 a.a.
NCBI ID   WP_001214081.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain XH1048     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 597180..631034 599545..599898 within 0


Gene organization within MGE regions


Location: 597180..631034
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RKQ71_RS03025 (RKQ71_03030) - 597180..598247 (+) 1068 WP_000107856.1 site-specific integrase -
  RKQ71_RS03030 (RKQ71_03035) - 598275..598571 (-) 297 WP_000218943.1 hypothetical protein -
  RKQ71_RS03035 (RKQ71_03040) - 598568..598789 (-) 222 WP_000424583.1 hypothetical protein -
  RKQ71_RS03040 (RKQ71_03045) - 598798..599535 (-) 738 WP_000125746.1 3'-5' exonuclease -
  RKQ71_RS03045 (RKQ71_03050) ssb 599545..599898 (-) 354 WP_001214081.1 single-stranded DNA-binding protein Machinery gene
  RKQ71_RS03050 (RKQ71_03055) - 599886..600203 (-) 318 WP_000049862.1 hypothetical protein -
  RKQ71_RS03055 (RKQ71_03060) - 600207..600725 (-) 519 WP_000877796.1 hypothetical protein -
  RKQ71_RS03060 (RKQ71_03065) - 600728..601159 (-) 432 WP_001178667.1 DUF2528 family protein -
  RKQ71_RS03065 (RKQ71_03070) - 601227..601562 (-) 336 WP_000841657.1 hypothetical protein -
  RKQ71_RS03070 (RKQ71_03075) - 601559..604297 (-) 2739 WP_025464780.1 toprim domain-containing protein -
  RKQ71_RS03075 (RKQ71_03080) - 604391..604582 (-) 192 WP_001043481.1 hypothetical protein -
  RKQ71_RS03080 (RKQ71_03085) - 604675..605016 (+) 342 WP_000786717.1 helix-turn-helix domain-containing protein -
  RKQ71_RS03085 (RKQ71_03090) - 605061..605276 (-) 216 WP_000556347.1 hypothetical protein -
  RKQ71_RS03090 (RKQ71_03095) - 605377..605622 (-) 246 WP_000789360.1 hypothetical protein -
  RKQ71_RS03095 (RKQ71_03100) - 605625..605819 (-) 195 WP_002001330.1 hypothetical protein -
  RKQ71_RS03100 (RKQ71_03105) - 606139..606462 (-) 324 WP_000720885.1 DUF2511 domain-containing protein -
  RKQ71_RS03105 (RKQ71_03110) - 606542..607183 (+) 642 WP_000332608.1 SOS response-associated peptidase -
  RKQ71_RS03110 (RKQ71_03115) - 607296..607796 (+) 501 WP_000072259.1 LexA family transcriptional regulator -
  RKQ71_RS03115 (RKQ71_03120) - 607793..609088 (+) 1296 WP_000679982.1 Y-family DNA polymerase -
  RKQ71_RS03120 (RKQ71_03125) - 609378..609578 (-) 201 WP_000130086.1 TraR/DksA C4-type zinc finger protein -
  RKQ71_RS03125 (RKQ71_03130) - 609575..609814 (-) 240 WP_000113727.1 ogr/Delta-like zinc finger family protein -
  RKQ71_RS03130 (RKQ71_03135) - 609943..611256 (-) 1314 WP_000483168.1 contractile injection system protein, VgrG/Pvc8 family -
  RKQ71_RS03135 (RKQ71_03140) - 611257..611697 (-) 441 WP_000979754.1 phage tail protein -
  RKQ71_RS03140 (RKQ71_03145) - 611703..614153 (-) 2451 WP_000774269.1 phage tail tape measure protein -
  RKQ71_RS03145 - 614167..614280 (-) 114 WP_074166825.1 GpE family phage tail protein -
  RKQ71_RS03150 (RKQ71_03150) - 614307..614648 (-) 342 WP_001071616.1 phage tail assembly protein -
  RKQ71_RS03155 (RKQ71_03155) - 614715..615233 (-) 519 WP_001207609.1 phage major tail tube protein -
  RKQ71_RS03160 (RKQ71_03160) - 615246..616421 (-) 1176 WP_000963363.1 phage tail sheath protein -
  RKQ71_RS03165 (RKQ71_03165) - 616521..616748 (-) 228 WP_001279430.1 hypothetical protein -
  RKQ71_RS03170 (RKQ71_03170) - 616750..618996 (-) 2247 WP_000729644.1 phage tail protein -
  RKQ71_RS03175 (RKQ71_03175) - 619008..619613 (-) 606 WP_001050806.1 phage tail protein I -
  RKQ71_RS03180 (RKQ71_03180) - 619613..620515 (-) 903 WP_000109741.1 baseplate J/gp47 family protein -
  RKQ71_RS03185 (RKQ71_03185) - 620512..620859 (-) 348 WP_000987743.1 GPW/gp25 family protein -
  RKQ71_RS03190 (RKQ71_03190) - 620856..621539 (-) 684 WP_000990627.1 phage baseplate assembly protein V -
  RKQ71_RS03195 (RKQ71_03195) - 621612..622061 (-) 450 WP_001059840.1 phage virion morphogenesis protein -
  RKQ71_RS03200 (RKQ71_03200) - 622058..622585 (-) 528 WP_000742887.1 phage tail protein -
  RKQ71_RS03205 (RKQ71_03205) - 622582..623412 (-) 831 WP_000600984.1 N-acetylmuramidase family protein -
  RKQ71_RS03210 (RKQ71_03210) - 623409..623678 (-) 270 WP_000571492.1 phage holin family protein -
  RKQ71_RS03215 (RKQ71_03215) - 623675..624025 (-) 351 WP_001114936.1 putative holin -
  RKQ71_RS03220 (RKQ71_03220) - 624034..624243 (-) 210 WP_000659473.1 tail protein X -
  RKQ71_RS03225 (RKQ71_03225) - 624244..624696 (-) 453 WP_000015689.1 head completion/stabilization protein -
  RKQ71_RS03230 (RKQ71_03230) gpM 624799..625500 (-) 702 WP_000950639.1 phage terminase small subunit -
  RKQ71_RS03235 (RKQ71_03235) - 625511..626500 (-) 990 WP_001243258.1 phage major capsid protein, P2 family -
  RKQ71_RS03240 (RKQ71_03240) - 626552..627382 (-) 831 WP_000748564.1 GPO family capsid scaffolding protein -
  RKQ71_RS03245 (RKQ71_03245) - 627520..629331 (+) 1812 WP_000289876.1 terminase large subunit domain-containing protein -
  RKQ71_RS03250 (RKQ71_03250) - 629331..630329 (+) 999 WP_001284080.1 phage portal protein -
  RKQ71_RS03255 (RKQ71_03255) - 630630..631034 (-) 405 WP_001037171.1 hypothetical protein -

Sequence


Protein


Download         Length: 117 a.a.        Molecular weight: 13319.05 Da        Isoelectric Point: 9.7939

>NTDB_id=881137 RKQ71_RS03045 WP_001214081.1 599545..599898(-) (ssb) [Acinetobacter baumannii strain XH1048]
MRGINKVILVGVLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQDRYVTEVRAITFQSLDSLPQANPV

Nucleotide


Download         Length: 354 bp        

>NTDB_id=881137 RKQ71_RS03045 WP_001214081.1 599545..599898(-) (ssb) [Acinetobacter baumannii strain XH1048]
ATGCGCGGAATAAACAAAGTGATATTGGTCGGTGTGCTTGGTGCCAATCCAATTCCTAAACAGTTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGAACTGGTGACTGGATTGAAAATACAGAGTGGC
ATCGTATTGTTGCCCACAACAGACTAGGAGAAATTGCCTGCCAATTTCTTAAAAAAGGTTCAAAAGTTTATATCGAAGGG
TCATTACATACACGGAAATGGACTGACCAAAACAATCAAGACCGTTACGTAACTGAAGTTAGAGCCATTACTTTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

56.364

94.017

0.53

  ssb Vibrio cholerae strain A1552

55.556

84.615

0.47

  ssb Neisseria gonorrhoeae MS11

41.905

89.744

0.376

  ssb Neisseria meningitidis MC58

41.905

89.744

0.376