Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   RF668_RS07460 Genome accession   NZ_CP133787
Coordinates   1443411..1443911 (+) Length   166 a.a.
NCBI ID   WP_309558437.1    Uniprot ID   A0AAX4AFB4
Organism   Lactococcus cremoris strain KCKM 0438     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1436457..1482764 1443411..1443911 within 0


Gene organization within MGE regions


Location: 1436457..1482764
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RF668_RS07405 (RF668_07405) - 1436457..1437596 (-) 1140 WP_309558420.1 site-specific integrase -
  RF668_RS07410 (RF668_07410) - 1437718..1438569 (-) 852 WP_309558421.1 CD20-like domain-containing protein -
  RF668_RS07415 (RF668_07415) - 1438629..1439024 (-) 396 WP_052750642.1 hypothetical protein -
  RF668_RS07420 (RF668_07420) - 1439034..1439390 (-) 357 WP_046782339.1 XRE family transcriptional regulator -
  RF668_RS07425 (RF668_07425) - 1439681..1439911 (+) 231 WP_011676017.1 hypothetical protein -
  RF668_RS07430 (RF668_07430) - 1439926..1440669 (+) 744 WP_309558428.1 ORF6C domain-containing protein -
  RF668_RS07435 (RF668_07435) - 1440683..1441021 (+) 339 WP_309558430.1 hypothetical protein -
  RF668_RS07440 (RF668_07440) - 1441101..1441349 (+) 249 WP_309558433.1 hypothetical protein -
  RF668_RS07445 (RF668_07445) - 1441346..1441522 (+) 177 WP_309558434.1 putative transcriptional regulator -
  RF668_RS07450 (RF668_07450) bet 1441627..1442364 (+) 738 WP_309558435.1 phage recombination protein Bet -
  RF668_RS07455 (RF668_07455) - 1442366..1443421 (+) 1056 WP_309558436.1 DUF1351 domain-containing protein -
  RF668_RS07460 (RF668_07460) ssb 1443411..1443911 (+) 501 WP_309558437.1 single-stranded DNA-binding protein Machinery gene
  RF668_RS07465 (RF668_07465) - 1444036..1444818 (+) 783 WP_023189114.1 phage replisome organiser protein -
  RF668_RS07470 (RF668_07470) - 1444818..1445543 (+) 726 WP_309558443.1 hypothetical protein -
  RF668_RS07475 (RF668_07475) - 1445540..1445929 (+) 390 WP_309558444.1 RusA family crossover junction endodeoxyribonuclease -
  RF668_RS07480 (RF668_07480) - 1445932..1446171 (+) 240 WP_309558446.1 DUF1031 family protein -
  RF668_RS07485 (RF668_07485) - 1446280..1446804 (+) 525 WP_309558448.1 hypothetical protein -
  RF668_RS07490 (RF668_07490) - 1446816..1447013 (+) 198 WP_011835825.1 DUF1125 domain-containing protein -
  RF668_RS07495 (RF668_07495) - 1447010..1447189 (+) 180 WP_043991166.1 hypothetical protein -
  RF668_RS07500 (RF668_07500) - 1447182..1447781 (+) 600 WP_309558451.1 DUF1642 domain-containing protein -
  RF668_RS07505 (RF668_07505) - 1447778..1447906 (+) 129 WP_309558453.1 hypothetical protein -
  RF668_RS07510 (RF668_07510) dut 1447922..1448341 (+) 420 WP_309558455.1 dUTP diphosphatase -
  RF668_RS07515 (RF668_07515) - 1448338..1448499 (+) 162 WP_309558457.1 hypothetical protein -
  RF668_RS07520 (RF668_07520) - 1448501..1448800 (+) 300 WP_309558459.1 hypothetical protein -
  RF668_RS07525 (RF668_07525) - 1448822..1448986 (+) 165 WP_010905701.1 hypothetical protein -
  RF668_RS07530 (RF668_07530) - 1449033..1449266 (+) 234 WP_309558463.1 hypothetical protein -
  RF668_RS07535 (RF668_07535) - 1449272..1449424 (+) 153 WP_309558465.1 DUF1660 family phage protein -
  RF668_RS07540 (RF668_07540) - 1449424..1449600 (+) 177 WP_240819312.1 hypothetical protein -
  RF668_RS07545 (RF668_07545) - 1450237..1450440 (+) 204 WP_270329675.1 hypothetical protein -
  RF668_RS07550 (RF668_07550) - 1450520..1450942 (+) 423 WP_063282440.1 RinA family protein -
  RF668_RS07555 (RF668_07555) - 1451186..1451698 (+) 513 WP_021722218.1 terminase small subunit -
  RF668_RS07560 (RF668_07560) - 1451688..1452923 (+) 1236 WP_240246932.1 PBSX family phage terminase large subunit -
  RF668_RS07565 (RF668_07565) - 1452932..1454440 (+) 1509 WP_309558468.1 phage portal protein -
  RF668_RS07570 (RF668_07570) - 1454397..1454573 (+) 177 WP_309558469.1 hypothetical protein -
  RF668_RS07575 (RF668_07575) - 1454615..1454845 (+) 231 WP_309558471.1 hypothetical protein -
  RF668_RS07580 (RF668_07580) - 1454842..1455129 (+) 288 WP_043735348.1 ribosomal-processing cysteine protease Prp -
  RF668_RS07585 (RF668_07585) - 1455135..1456241 (+) 1107 WP_309558473.1 minor capsid protein -
  RF668_RS07590 (RF668_07590) - 1456406..1457062 (+) 657 WP_043735806.1 DUF4355 domain-containing protein -
  RF668_RS07595 (RF668_07595) - 1457075..1458193 (+) 1119 WP_309558474.1 Ig-like domain-containing protein -
  RF668_RS07600 (RF668_07600) - 1458214..1458546 (+) 333 WP_043735342.1 phage head-tail connector protein -
  RF668_RS07605 (RF668_07605) - 1458527..1458880 (+) 354 WP_309558475.1 hypothetical protein -
  RF668_RS07610 (RF668_07610) - 1458864..1459412 (+) 549 WP_014024892.1 hypothetical protein -
  RF668_RS07615 (RF668_07615) - 1459412..1459774 (+) 363 WP_014024891.1 hypothetical protein -
  RF668_RS07620 (RF668_07620) - 1459787..1460212 (+) 426 WP_309558478.1 phage tail tube protein -
  RF668_RS07625 (RF668_07625) - 1460285..1460695 (+) 411 WP_309558480.1 DUF6096 family protein -
  RF668_RS07630 (RF668_07630) - 1460719..1461090 (+) 372 WP_309558482.1 hypothetical protein -
  RF668_RS07635 (RF668_07635) - 1461121..1465902 (+) 4782 WP_309558483.1 phage tail protein -
  RF668_RS07640 (RF668_07640) - 1465914..1466279 (+) 366 WP_309558485.1 DUF6711 family protein -
  RF668_RS07645 (RF668_07645) - 1466292..1468793 (+) 2502 WP_309558487.1 gp58-like family protein -
  RF668_RS07650 (RF668_07650) - 1468790..1468927 (+) 138 WP_309558488.1 hypothetical protein -
  RF668_RS07655 (RF668_07655) - 1468927..1470390 (+) 1464 WP_309558490.1 hypothetical protein -
  RF668_RS07660 (RF668_07660) - 1470408..1470626 (+) 219 WP_309558491.1 hemolysin XhlA family protein -
  RF668_RS07665 (RF668_07665) - 1470640..1470864 (+) 225 WP_043735322.1 phage holin -
  RF668_RS07670 (RF668_07670) - 1470861..1472150 (+) 1290 WP_309558493.1 LysM peptidoglycan-binding domain-containing protein -
  RF668_RS07675 (RF668_07675) - 1472255..1472614 (+) 360 WP_254255777.1 YxeA family protein -
  RF668_RS07680 (RF668_07680) - 1472820..1473308 (+) 489 WP_309558496.1 hypothetical protein -
  RF668_RS07685 (RF668_07685) - 1473292..1473756 (+) 465 WP_309558497.1 hypothetical protein -
  RF668_RS07690 (RF668_07690) - 1473743..1474558 (+) 816 WP_309558498.1 hypothetical protein -
  RF668_RS07700 (RF668_07700) - 1475364..1476089 (+) 726 WP_309558499.1 type II toxin-antitoxin system PemK/MazF family toxin -
  RF668_RS07710 (RF668_07710) - 1476608..1477378 (-) 771 WP_021211942.1 hypothetical protein -
  RF668_RS07715 (RF668_07715) - 1477486..1478136 (-) 651 WP_052206569.1 Ltp family lipoprotein -
  RF668_RS07720 (RF668_07720) - 1478521..1478682 (+) 162 WP_185752997.1 hypothetical protein -
  RF668_RS07725 (RF668_07725) - 1478764..1479066 (+) 303 WP_043735258.1 MazG-like protein -
  RF668_RS07735 (RF668_07735) arsC 1479810..1480214 (+) 405 WP_021165525.1 arsenate reductase (thioredoxin) -
  RF668_RS07740 (RF668_07740) - 1480326..1481162 (+) 837 WP_043735256.1 metallophosphoesterase -
  RF668_RS07745 (RF668_07745) - 1481255..1482166 (+) 912 WP_043735255.1 CHAP domain-containing protein -
  RF668_RS07750 (RF668_07750) - 1482402..1482764 (+) 363 WP_043735253.1 TIGR02328 family protein -

Sequence


Protein


Download         Length: 166 a.a.        Molecular weight: 18354.18 Da        Isoelectric Point: 5.2389

>NTDB_id=876888 RF668_RS07460 WP_309558437.1 1443411..1443911(+) (ssb) [Lactococcus cremoris strain KCKM 0438]
MINNVTLVGRITKEPELRYTPQNQAVATFSLAVNRQFKNANGEREADFINCVIWRQQAENFANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADSFQMLESRSAREGMGGGTSAGSYSVPSQSTNNTPRPQTNNNNATPNFGRDADPFGSSPMEIS
DDDLPF

Nucleotide


Download         Length: 501 bp        

>NTDB_id=876888 RF668_RS07460 WP_309558437.1 1443411..1443911(+) (ssb) [Lactococcus cremoris strain KCKM 0438]
ATGATAAATAATGTCACTCTAGTAGGAAGAATCACTAAAGAACCTGAACTGAGATACACCCCTCAAAATCAAGCTGTCGC
AACATTTTCATTGGCTGTAAACCGTCAATTTAAAAATGCGAATGGCGAACGTGAGGCTGATTTCATTAACTGCGTTATTT
GGCGCCAACAAGCTGAGAATTTTGCGAATTGGGCTAAAAAAGGAGCTTTGATTGGGGTAACTGGTCGAATTCAAACACGT
AACTATGAAAATCAACAAGGTCAACGGGTTTATGTGACTGAGGTTGTGGCTGACAGTTTCCAAATGTTGGAAAGTAGATC
TGCTCGTGAAGGTATGGGAGGCGGAACTTCTGCTGGTTCATATTCTGTACCTAGCCAATCTACAAATAATACTCCACGTC
CACAAACGAATAACAATAATGCAACACCGAATTTCGGTCGTGATGCTGATCCATTTGGTAGCTCACCGATGGAAATTTCA
GATGATGACCTACCATTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

59.302

100

0.614

  ssbA Bacillus subtilis subsp. subtilis str. 168

57.225

100

0.596

  ssbB Bacillus subtilis subsp. subtilis str. 168

58.491

63.855

0.373

  ssb Glaesserella parasuis strain SC1401

33.898

100

0.361