Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | RGU79_RS02740 | Genome accession | NZ_CP133717 |
| Coordinates | 554953..555306 (-) | Length | 117 a.a. |
| NCBI ID | WP_002014678.1 | Uniprot ID | A0A0D5YEH0 |
| Organism | Acinetobacter baumannii strain Ab1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 552586..587715 | 554953..555306 | within | 0 |
Gene organization within MGE regions
Location: 552586..587715
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RGU79_RS02720 (RGU79_02725) | - | 552586..553653 (+) | 1068 | WP_342041241.1 | site-specific integrase | - |
| RGU79_RS02725 (RGU79_02730) | - | 553682..553978 (-) | 297 | WP_000218943.1 | hypothetical protein | - |
| RGU79_RS02730 (RGU79_02735) | - | 553975..554196 (-) | 222 | WP_033917270.1 | hypothetical protein | - |
| RGU79_RS02735 (RGU79_02740) | - | 554206..554943 (-) | 738 | WP_253633981.1 | 3'-5' exonuclease | - |
| RGU79_RS02740 (RGU79_02745) | ssb | 554953..555306 (-) | 354 | WP_002014678.1 | single-stranded DNA-binding protein | Machinery gene |
| RGU79_RS02745 (RGU79_02750) | - | 555294..555611 (-) | 318 | WP_317364478.1 | hypothetical protein | - |
| RGU79_RS02750 (RGU79_02755) | - | 555604..555774 (-) | 171 | WP_001015076.1 | hypothetical protein | - |
| RGU79_RS02755 (RGU79_02760) | - | 555764..556315 (-) | 552 | WP_001178668.1 | hypothetical protein | - |
| RGU79_RS02760 (RGU79_02765) | - | 556381..556713 (-) | 333 | WP_317364476.1 | hypothetical protein | - |
| RGU79_RS02765 (RGU79_02770) | - | 556710..559448 (-) | 2739 | WP_317364474.1 | toprim domain-containing protein | - |
| RGU79_RS02770 (RGU79_02775) | - | 559542..559730 (-) | 189 | WP_001043170.1 | hypothetical protein | - |
| RGU79_RS02775 (RGU79_02780) | - | 559823..560164 (+) | 342 | WP_000786718.1 | helix-turn-helix transcriptional regulator | - |
| RGU79_RS02780 (RGU79_02785) | - | 560209..560424 (-) | 216 | WP_000556352.1 | hypothetical protein | - |
| RGU79_RS02785 (RGU79_02790) | - | 560549..561373 (-) | 825 | WP_002056074.1 | Rha family transcriptional regulator | - |
| RGU79_RS02790 (RGU79_02795) | - | 561481..561675 (-) | 195 | WP_002056034.1 | hypothetical protein | - |
| RGU79_RS02795 (RGU79_02800) | - | 561991..562725 (+) | 735 | WP_261472399.1 | hypothetical protein | - |
| RGU79_RS02800 (RGU79_02805) | - | 562749..563189 (+) | 441 | WP_261472397.1 | hypothetical protein | - |
| RGU79_RS02805 (RGU79_02810) | - | 563222..563494 (-) | 273 | WP_261472396.1 | hypothetical protein | - |
| RGU79_RS02810 (RGU79_02815) | - | 563495..563695 (-) | 201 | WP_000130087.1 | TraR/DksA C4-type zinc finger protein | - |
| RGU79_RS02815 (RGU79_02820) | - | 563692..563931 (-) | 240 | WP_000113725.1 | ogr/Delta-like zinc finger family protein | - |
| RGU79_RS02820 (RGU79_02825) | - | 564063..565376 (-) | 1314 | WP_261472393.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| RGU79_RS02825 (RGU79_02830) | - | 565377..565817 (-) | 441 | WP_261472391.1 | phage tail protein | - |
| RGU79_RS02830 (RGU79_02835) | - | 565823..568516 (-) | 2694 | WP_261472390.1 | phage tail tape measure protein | - |
| RGU79_RS02835 | - | 568530..568643 (-) | 114 | WP_002013839.1 | GpE family phage tail protein | - |
| RGU79_RS02840 (RGU79_02840) | - | 568670..569011 (-) | 342 | WP_001071617.1 | phage tail assembly protein | - |
| RGU79_RS02845 (RGU79_02845) | - | 569079..569597 (-) | 519 | WP_033917280.1 | phage major tail tube protein | - |
| RGU79_RS02850 (RGU79_02850) | - | 569610..570785 (-) | 1176 | WP_000963361.1 | phage tail sheath protein | - |
| RGU79_RS02855 (RGU79_02855) | - | 570885..572948 (-) | 2064 | WP_052146683.1 | phage tail protein | - |
| RGU79_RS02860 (RGU79_02860) | - | 572960..573565 (-) | 606 | WP_033917281.1 | phage tail protein I | - |
| RGU79_RS02865 (RGU79_02865) | - | 573565..574467 (-) | 903 | WP_199984425.1 | baseplate J/gp47 family protein | - |
| RGU79_RS02870 (RGU79_02870) | - | 574464..574811 (-) | 348 | WP_033917283.1 | GPW/gp25 family protein | - |
| RGU79_RS02875 (RGU79_02875) | - | 574808..575440 (-) | 633 | WP_342041242.1 | phage baseplate assembly protein V | - |
| RGU79_RS02880 (RGU79_02880) | - | 575513..575962 (-) | 450 | WP_033917285.1 | phage virion morphogenesis protein | - |
| RGU79_RS02885 (RGU79_02885) | - | 575959..576486 (-) | 528 | WP_033917286.1 | phage tail protein | - |
| RGU79_RS02890 (RGU79_02890) | - | 576483..577313 (-) | 831 | WP_033917287.1 | N-acetylmuramidase family protein | - |
| RGU79_RS02895 (RGU79_02895) | - | 577310..577579 (-) | 270 | WP_033917288.1 | phage holin family protein | - |
| RGU79_RS02900 (RGU79_02900) | - | 577576..577926 (-) | 351 | WP_001114936.1 | putative holin | - |
| RGU79_RS02905 (RGU79_02905) | - | 577935..578144 (-) | 210 | WP_033917289.1 | tail protein X | - |
| RGU79_RS02910 (RGU79_02910) | - | 578145..578597 (-) | 453 | WP_033917290.1 | head completion/stabilization protein | - |
| RGU79_RS02915 (RGU79_02915) | gpM | 578701..579465 (-) | 765 | WP_033917291.1 | phage terminase small subunit | - |
| RGU79_RS02920 (RGU79_02920) | - | 579474..580487 (-) | 1014 | WP_033917292.1 | phage major capsid protein, P2 family | - |
| RGU79_RS02925 (RGU79_02925) | - | 580493..581296 (-) | 804 | WP_033917293.1 | GPO family capsid scaffolding protein | - |
| RGU79_RS02930 (RGU79_02930) | - | 581455..583239 (+) | 1785 | WP_033917294.1 | terminase family protein | - |
| RGU79_RS02935 (RGU79_02935) | - | 583240..584247 (+) | 1008 | WP_033917295.1 | phage portal protein | - |
| RGU79_RS02940 (RGU79_02940) | - | 585386..586087 (+) | 702 | WP_000968982.1 | DUF3761 domain-containing protein | - |
| RGU79_RS02945 (RGU79_02945) | - | 586469..586567 (+) | 99 | Protein_561 | XRE family transcriptional regulator | - |
| RGU79_RS02950 (RGU79_02950) | - | 586592..587482 (+) | 891 | WP_002056033.1 | hypothetical protein | - |
| RGU79_RS02955 (RGU79_02955) | - | 587500..587715 (-) | 216 | WP_000556349.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13365.13 Da Isoelectric Point: 9.7939
>NTDB_id=876058 RGU79_RS02740 WP_002014678.1 554953..555306(-) (ssb) [Acinetobacter baumannii strain Ab1]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=876058 RGU79_RS02740 WP_002014678.1 554953..555306(-) (ssb) [Acinetobacter baumannii strain Ab1]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCCATTCCTAAACAATTTCAAAACGGTGGTTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAGGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCTGTTTAA
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCCATTCCTAAACAATTTCAAAACGGTGGTTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAGGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCTGTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.455 |
94.017 |
0.521 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |