Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | RGU78_RS02745 | Genome accession | NZ_CP133712 |
| Coordinates | 555163..555516 (-) | Length | 117 a.a. |
| NCBI ID | WP_002014678.1 | Uniprot ID | A0A0D5YEH0 |
| Organism | Acinetobacter baumannii strain CRAb1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 552796..587925 | 555163..555516 | within | 0 |
Gene organization within MGE regions
Location: 552796..587925
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RGU78_RS02725 (RGU78_02730) | - | 552796..553863 (+) | 1068 | WP_342041241.1 | site-specific integrase | - |
| RGU78_RS02730 (RGU78_02735) | - | 553892..554188 (-) | 297 | WP_000218943.1 | hypothetical protein | - |
| RGU78_RS02735 (RGU78_02740) | - | 554185..554406 (-) | 222 | WP_033917270.1 | hypothetical protein | - |
| RGU78_RS02740 (RGU78_02745) | - | 554416..555153 (-) | 738 | WP_253633981.1 | 3'-5' exonuclease | - |
| RGU78_RS02745 (RGU78_02750) | ssb | 555163..555516 (-) | 354 | WP_002014678.1 | single-stranded DNA-binding protein | Machinery gene |
| RGU78_RS02750 (RGU78_02755) | - | 555504..555821 (-) | 318 | WP_317364478.1 | hypothetical protein | - |
| RGU78_RS02755 (RGU78_02760) | - | 555814..555984 (-) | 171 | WP_001015076.1 | hypothetical protein | - |
| RGU78_RS02760 (RGU78_02765) | - | 555974..556525 (-) | 552 | WP_001178668.1 | hypothetical protein | - |
| RGU78_RS02765 (RGU78_02770) | - | 556591..556923 (-) | 333 | WP_317364476.1 | hypothetical protein | - |
| RGU78_RS02770 (RGU78_02775) | - | 556920..559658 (-) | 2739 | WP_317364474.1 | toprim domain-containing protein | - |
| RGU78_RS02775 (RGU78_02780) | - | 559752..559940 (-) | 189 | WP_001043170.1 | hypothetical protein | - |
| RGU78_RS02780 (RGU78_02785) | - | 560033..560374 (+) | 342 | WP_000786718.1 | helix-turn-helix transcriptional regulator | - |
| RGU78_RS02785 (RGU78_02790) | - | 560419..560634 (-) | 216 | WP_000556352.1 | hypothetical protein | - |
| RGU78_RS02790 (RGU78_02795) | - | 560759..561583 (-) | 825 | WP_002056074.1 | Rha family transcriptional regulator | - |
| RGU78_RS02795 (RGU78_02800) | - | 561691..561885 (-) | 195 | WP_002056034.1 | hypothetical protein | - |
| RGU78_RS02800 (RGU78_02805) | - | 562201..562935 (+) | 735 | WP_261472399.1 | hypothetical protein | - |
| RGU78_RS02805 (RGU78_02810) | - | 562959..563399 (+) | 441 | WP_261472397.1 | hypothetical protein | - |
| RGU78_RS02810 (RGU78_02815) | - | 563432..563704 (-) | 273 | WP_261472396.1 | hypothetical protein | - |
| RGU78_RS02815 (RGU78_02820) | - | 563705..563905 (-) | 201 | WP_000130087.1 | TraR/DksA C4-type zinc finger protein | - |
| RGU78_RS02820 (RGU78_02825) | - | 563902..564141 (-) | 240 | WP_000113725.1 | ogr/Delta-like zinc finger family protein | - |
| RGU78_RS02825 (RGU78_02830) | - | 564273..565586 (-) | 1314 | WP_261472393.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| RGU78_RS02830 (RGU78_02835) | - | 565587..566027 (-) | 441 | WP_261472391.1 | phage tail protein | - |
| RGU78_RS02835 (RGU78_02840) | - | 566033..568726 (-) | 2694 | WP_261472390.1 | phage tail tape measure protein | - |
| RGU78_RS02840 | - | 568740..568853 (-) | 114 | WP_002013839.1 | GpE family phage tail protein | - |
| RGU78_RS02845 (RGU78_02845) | - | 568880..569221 (-) | 342 | WP_001071617.1 | phage tail assembly protein | - |
| RGU78_RS02850 (RGU78_02850) | - | 569289..569807 (-) | 519 | WP_033917280.1 | phage major tail tube protein | - |
| RGU78_RS02855 (RGU78_02855) | - | 569820..570995 (-) | 1176 | WP_000963361.1 | phage tail sheath protein | - |
| RGU78_RS02860 (RGU78_02860) | - | 571095..573158 (-) | 2064 | WP_052146683.1 | phage tail protein | - |
| RGU78_RS02865 (RGU78_02865) | - | 573170..573775 (-) | 606 | WP_033917281.1 | phage tail protein I | - |
| RGU78_RS02870 (RGU78_02870) | - | 573775..574677 (-) | 903 | WP_199984425.1 | baseplate J/gp47 family protein | - |
| RGU78_RS02875 (RGU78_02875) | - | 574674..575021 (-) | 348 | WP_033917283.1 | GPW/gp25 family protein | - |
| RGU78_RS02880 (RGU78_02880) | - | 575018..575650 (-) | 633 | WP_342041242.1 | phage baseplate assembly protein V | - |
| RGU78_RS02885 (RGU78_02885) | - | 575723..576172 (-) | 450 | WP_033917285.1 | phage virion morphogenesis protein | - |
| RGU78_RS02890 (RGU78_02890) | - | 576169..576696 (-) | 528 | WP_033917286.1 | phage tail protein | - |
| RGU78_RS02895 (RGU78_02895) | - | 576693..577523 (-) | 831 | WP_033917287.1 | N-acetylmuramidase family protein | - |
| RGU78_RS02900 (RGU78_02900) | - | 577520..577789 (-) | 270 | WP_033917288.1 | phage holin family protein | - |
| RGU78_RS02905 (RGU78_02905) | - | 577786..578136 (-) | 351 | WP_001114936.1 | putative holin | - |
| RGU78_RS02910 (RGU78_02910) | - | 578145..578354 (-) | 210 | WP_033917289.1 | tail protein X | - |
| RGU78_RS02915 (RGU78_02915) | - | 578355..578807 (-) | 453 | WP_033917290.1 | head completion/stabilization protein | - |
| RGU78_RS02920 (RGU78_02920) | gpM | 578911..579675 (-) | 765 | WP_033917291.1 | phage terminase small subunit | - |
| RGU78_RS02925 (RGU78_02925) | - | 579684..580697 (-) | 1014 | WP_033917292.1 | phage major capsid protein, P2 family | - |
| RGU78_RS02930 (RGU78_02930) | - | 580703..581506 (-) | 804 | WP_033917293.1 | GPO family capsid scaffolding protein | - |
| RGU78_RS02935 (RGU78_02935) | - | 581665..583449 (+) | 1785 | WP_033917294.1 | terminase family protein | - |
| RGU78_RS02940 (RGU78_02940) | - | 583450..584457 (+) | 1008 | WP_033917295.1 | phage portal protein | - |
| RGU78_RS02945 (RGU78_02945) | - | 584463..584759 (+) | 297 | WP_033917296.1 | hypothetical protein | - |
| RGU78_RS02950 (RGU78_02950) | - | 585596..586297 (+) | 702 | WP_000968982.1 | DUF3761 domain-containing protein | - |
| RGU78_RS02955 (RGU78_02955) | - | 586679..586777 (+) | 99 | Protein_562 | XRE family transcriptional regulator | - |
| RGU78_RS02960 (RGU78_02960) | - | 586802..587692 (+) | 891 | WP_002056033.1 | hypothetical protein | - |
| RGU78_RS02965 (RGU78_02965) | - | 587710..587925 (-) | 216 | WP_000556349.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13365.13 Da Isoelectric Point: 9.7939
>NTDB_id=876010 RGU78_RS02745 WP_002014678.1 555163..555516(-) (ssb) [Acinetobacter baumannii strain CRAb1]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=876010 RGU78_RS02745 WP_002014678.1 555163..555516(-) (ssb) [Acinetobacter baumannii strain CRAb1]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCCATTCCTAAACAATTTCAAAACGGTGGTTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAGGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCTGTTTAA
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCCATTCCTAAACAATTTCAAAACGGTGGTTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAGGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCTGTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.455 |
94.017 |
0.521 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |