Detailed information    

insolico Bioinformatically predicted

Overview


Name   ideA   Type   Regulator
Locus tag   RDI66_RS04865 Genome accession   NZ_CP133492
Coordinates   1052359..1053042 (-) Length   227 a.a.
NCBI ID   WP_156734072.1    Uniprot ID   A0A6G6TED8
Organism   Pasteurella multocida strain PM140     
Function   repress natural transformation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 976995..1081555 1052359..1053042 within 0


Gene organization within MGE regions


Location: 976995..1081555
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RDI66_RS04600 (RDI66_04600) - 976995..979013 (+) 2019 WP_309042821.1 ATP-binding protein -
  RDI66_RS04605 (RDI66_04605) - 979143..980384 (-) 1242 WP_001218618.1 integrase family protein -
  RDI66_RS04610 (RDI66_04610) - 980386..980532 (-) 147 WP_001922873.1 hypothetical protein -
  RDI66_RS04615 (RDI66_04615) - 980658..981632 (-) 975 WP_000497807.1 ParM/StbA family protein -
  RDI66_RS04620 (RDI66_04620) mobI 982097..982540 (+) 444 WP_000348524.1 conjugative transfer protein MobI(A/C) -
  RDI66_RS04625 (RDI66_04625) umuC 982551..983516 (-) 966 WP_223293465.1 translesion error-prone DNA polymerase V subunit UmuC -
  RDI66_RS04630 (RDI66_04630) - 983946..985379 (-) 1434 WP_003152694.1 multidrug efflux transporter outer membrane subunit TOprJ1 -
  RDI66_RS04635 (RDI66_04635) - 985384..988518 (-) 3135 WP_034065037.1 multidrug efflux RND transporter permease subunit TMexD3 -
  RDI66_RS04640 (RDI66_04640) tmexC 988534..989697 (-) 1164 WP_065285147.1 multidrug efflux RND transporter periplasmic adaptor subunit TMexC -
  RDI66_RS04645 (RDI66_04645) - 989877..990434 (+) 558 WP_003152690.1 TetR/AcrR family transcriptional regulator -
  RDI66_RS04650 (RDI66_04650) - 990561..991931 (+) 1371 WP_065285146.1 IS1182-like element ISCfr1 family transposase -
  RDI66_RS04655 (RDI66_04655) - 992481..995171 (+) 2691 WP_058131653.1 AAA family ATPase -
  RDI66_RS04660 (RDI66_04660) - 995239..995703 (-) 465 WP_023443007.1 hypothetical protein -
  RDI66_RS04665 (RDI66_04665) - 995684..997723 (-) 2040 WP_034039551.1 hypothetical protein -
  RDI66_RS04670 (RDI66_04670) - 997720..999450 (-) 1731 WP_034039553.1 site-specific integrase -
  RDI66_RS04675 (RDI66_04675) - 999443..1000732 (-) 1290 WP_034039555.1 site-specific integrase -
  RDI66_RS04680 (RDI66_04680) - 1001308..1001901 (+) 594 WP_000107352.1 Tn3 family transposase -
  RDI66_RS04685 (RDI66_04685) - 1002015..1003328 (+) 1314 Protein_898 DUF4158 domain-containing protein -
  RDI66_RS04690 (RDI66_04690) - 1004007..1004240 (-) 234 Protein_899 DNA polymerase V subunit UmuC -
  RDI66_RS04695 (RDI66_04695) umuD 1004248..1004697 (-) 450 WP_000116661.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
  RDI66_RS04700 (RDI66_04700) - 1004696..1004953 (+) 258 WP_000182836.1 hypothetical protein -
  RDI66_RS04705 (RDI66_04705) - 1005336..1006241 (+) 906 WP_000196208.1 3'-5' exonuclease -
  RDI66_RS04710 (RDI66_04710) - 1006329..1006643 (+) 315 WP_000284113.1 hypothetical protein -
  RDI66_RS04715 (RDI66_04715) - 1006712..1007638 (+) 927 WP_001883760.1 WYL domain-containing protein -
  RDI66_RS04720 (RDI66_04720) - 1007648..1008247 (+) 600 WP_156734109.1 DUF1819 family protein -
  RDI66_RS04725 (RDI66_04725) - 1008244..1008828 (+) 585 WP_000645939.1 DUF1788 domain-containing protein -
  RDI66_RS04730 (RDI66_04730) brxC 1008847..1012524 (+) 3678 WP_156734107.1 BREX system P-loop protein BrxC -
  RDI66_RS04735 (RDI66_04735) - 1012541..1014304 (+) 1764 WP_010129446.1 DUF262 domain-containing protein -
  RDI66_RS04740 (RDI66_04740) pglX 1014320..1018021 (+) 3702 WP_011117362.1 BREX-1 system adenine-specific DNA-methyltransferase PglX -
  RDI66_RS04745 (RDI66_04745) pglZ 1018021..1020678 (+) 2658 WP_156734105.1 BREX-1 system phosphatase PglZ type A -
  RDI66_RS04750 (RDI66_04750) brxL 1020695..1022770 (+) 2076 WP_156734103.1 protease Lon-related BREX system protein BrxL -
  RDI66_RS04755 (RDI66_04755) - 1022921..1027225 (+) 4305 WP_156734101.1 NACHT domain-containing NTPase -
  RDI66_RS04760 (RDI66_04760) mobH 1027368..1029518 (+) 2151 WP_156734099.1 MobH family relaxase -
  RDI66_RS04765 (RDI66_04765) traD 1029567..1031387 (+) 1821 WP_309042822.1 conjugative transfer system coupling protein TraD -
  RDI66_RS04770 (RDI66_04770) - 1031397..1031957 (+) 561 WP_170355933.1 conjugative transfer protein -
  RDI66_RS04775 (RDI66_04775) - 1031944..1032579 (+) 636 WP_170355931.1 DUF4400 domain-containing protein -
  RDI66_RS04780 (RDI66_04780) - 1032606..1033193 (-) 588 WP_087504523.1 plasmid-related protein -
  RDI66_RS04785 (RDI66_04785) traL 1033481..1033762 (+) 282 WP_000433891.1 type IV conjugative transfer system protein TraL -
  RDI66_RS04790 (RDI66_04790) - 1033759..1034385 (+) 627 WP_000667170.1 TraE/TraK family type IV conjugative transfer system protein -
  RDI66_RS04795 (RDI66_04795) - 1034366..1035265 (+) 900 WP_373463497.1 type-F conjugative transfer system secretin TraK -
  RDI66_RS04800 (RDI66_04800) - 1035268..1036557 (+) 1290 WP_170383165.1 TraB/VirB10 family protein -
  RDI66_RS04805 (RDI66_04805) traV 1036632..1037204 (+) 573 WP_001944091.1 type IV conjugative transfer system lipoprotein TraV -
  RDI66_RS04810 (RDI66_04810) traA 1037201..1037587 (+) 387 WP_000180225.1 TraA family conjugative transfer protein -
  RDI66_RS04815 (RDI66_04815) - 1037807..1038583 (+) 777 WP_170355935.1 type IV toxin-antitoxin system AbiEi family antitoxin -
  RDI66_RS04820 (RDI66_04820) - 1038591..1039529 (+) 939 WP_170355928.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
  RDI66_RS04825 (RDI66_04825) - 1039661..1040353 (+) 693 WP_001228924.1 DsbC family protein -
  RDI66_RS04830 (RDI66_04830) traC 1040353..1042752 (+) 2400 WP_170355926.1 type IV secretion system protein TraC -
  RDI66_RS04835 (RDI66_04835) - 1042745..1043092 (+) 348 WP_156734078.1 plasmid-related protein -
  RDI66_RS04840 (RDI66_04840) - 1043076..1043588 (+) 513 WP_170355924.1 S26 family signal peptidase -
  RDI66_RS04845 (RDI66_04845) - 1043596..1044723 (+) 1128 WP_238795189.1 TrbC family F-type conjugative pilus assembly protein -
  RDI66_RS04850 (RDI66_04850) - 1044707..1045735 (+) 1029 WP_156734076.1 TraU family protein -
  RDI66_RS04855 (RDI66_04855) traN 1045738..1049430 (+) 3693 WP_170355921.1 conjugal transfer protein TraN -
  RDI66_RS04860 (RDI66_04860) - 1049521..1052124 (-) 2604 WP_205884524.1 AAA family ATPase -
  RDI66_RS04865 (RDI66_04865) ideA 1052359..1053042 (-) 684 WP_156734072.1 endonuclease Regulator
  RDI66_RS04870 (RDI66_04870) - 1053151..1053753 (-) 603 WP_309042823.1 hypothetical protein -
  RDI66_RS04875 (RDI66_04875) - 1054121..1054447 (+) 327 WP_156734069.1 plasmid-related protein -
  RDI66_RS04880 (RDI66_04880) - 1054463..1054882 (+) 420 WP_012368368.1 single-stranded DNA-binding protein -
  RDI66_RS04885 (RDI66_04885) bet 1054962..1055780 (+) 819 WP_000414662.1 phage recombination protein Bet -
  RDI66_RS04890 (RDI66_04890) - 1055864..1056007 (+) 144 WP_170355919.1 hypothetical protein -
  RDI66_RS04895 (RDI66_04895) - 1056068..1057084 (+) 1017 WP_170355917.1 YqaJ viral recombinase family protein -
  RDI66_RS04900 (RDI66_04900) - 1057294..1058253 (+) 960 WP_001959209.1 AAA family ATPase -
  RDI66_RS04905 (RDI66_04905) - 1058253..1059020 (+) 768 WP_170355915.1 hypothetical protein -
  RDI66_RS04910 (RDI66_04910) - 1059119..1060072 (+) 954 WP_170355913.1 DUF3150 domain-containing protein -
  RDI66_RS04915 (RDI66_04915) - 1060134..1060574 (+) 441 WP_170355911.1 hypothetical protein -
  RDI66_RS04920 (RDI66_04920) - 1060644..1062299 (+) 1656 WP_170355909.1 VWA domain-containing protein -
  RDI66_RS04925 (RDI66_04925) radC 1062383..1062880 (+) 498 WP_025610838.1 DNA repair protein RadC -
  RDI66_RS04930 (RDI66_04930) - 1062880..1063221 (+) 342 WP_025610839.1 hypothetical protein -
  RDI66_RS04935 (RDI66_04935) - 1063313..1064386 (+) 1074 WP_170355907.1 primase-helicase zinc-binding domain-containing protein -
  RDI66_RS04940 (RDI66_04940) - 1064476..1065183 (+) 708 WP_170355905.1 hypothetical protein -
  RDI66_RS04945 (RDI66_04945) - 1065318..1071047 (+) 5730 WP_265028167.1 ATP-binding protein -
  RDI66_RS04950 (RDI66_04950) - 1071174..1072118 (+) 945 WP_170355900.1 thioredoxin family protein -
  RDI66_RS04955 (RDI66_04955) - 1072121..1073509 (+) 1389 WP_025587948.1 conjugal transfer protein TraH -
  RDI66_RS04960 (RDI66_04960) - 1073513..1077082 (+) 3570 WP_170355898.1 conjugal transfer protein TraG N-terminal domain-containing protein -
  RDI66_RS04965 (RDI66_04965) eexR 1077115..1077546 (-) 432 WP_000183214.1 entry exclusion protein EexR -
  RDI66_RS04970 (RDI66_04970) - 1077604..1078137 (-) 534 WP_000566753.1 FlhC family transcriptional regulator -
  RDI66_RS04975 (RDI66_04975) - 1078134..1078433 (-) 300 WP_000210563.1 flagellar transcriptional regulator FlhD -
  RDI66_RS04980 (RDI66_04980) - 1078430..1078978 (-) 549 WP_170355896.1 lytic transglycosylase domain-containing protein -
  RDI66_RS04985 (RDI66_04985) - 1078965..1079627 (-) 663 WP_032081042.1 DUF6475 domain-containing protein -
  RDI66_RS04990 (RDI66_04990) - 1079614..1080483 (-) 870 WP_025515463.1 hypothetical protein -
  RDI66_RS04995 (RDI66_04995) - 1080539..1080790 (-) 252 WP_000451746.1 helix-turn-helix domain-containing protein -
  RDI66_RS05000 (RDI66_05000) - 1080908..1081555 (+) 648 WP_000854920.1 LexA family transcriptional regulator -

Sequence


Protein


Download         Length: 227 a.a.        Molecular weight: 26453.59 Da        Isoelectric Point: 7.5402

>NTDB_id=874772 RDI66_RS04865 WP_156734072.1 1052359..1053042(-) (ideA) [Pasteurella multocida strain PM140]
MNRTNFFVTFFIALFAIPAIAEHPTSFSQAKRFAREIYQDNQSTFYCGCSYNNDGAIDAASCGYEPRKQPKRGERLEWEH
VVSAWEIGHQRQCWQNGGRRNCEKNDPEFSKMVSDLHNLVPSVGELNGDRSNFRFGMIPNEPRAYGLCDFEVDFKDRRAE
PPANRQGDIARIYFYMRDQYGLRLSRQQTQLFEAWSRMDPVDEWEKLRDLRIRGIQGKSNCYVSGSC

Nucleotide


Download         Length: 684 bp        

>NTDB_id=874772 RDI66_RS04865 WP_156734072.1 1052359..1053042(-) (ideA) [Pasteurella multocida strain PM140]
ATGAATAGAACTAATTTTTTCGTTACTTTCTTTATAGCGCTGTTCGCTATACCTGCAATTGCAGAACACCCCACATCGTT
CAGTCAGGCAAAACGATTTGCCCGTGAAATTTACCAAGACAACCAGAGTACGTTTTACTGTGGATGTAGCTATAACAATG
ATGGTGCGATTGATGCTGCATCTTGCGGATATGAACCAAGGAAGCAACCGAAACGAGGAGAACGCTTAGAGTGGGAGCAC
GTTGTCTCAGCATGGGAAATTGGCCATCAACGCCAATGCTGGCAAAACGGTGGACGTCGGAACTGCGAAAAGAATGATCC
TGAGTTTTCTAAAATGGTGTCGGATCTCCATAACCTTGTACCATCTGTAGGAGAACTCAATGGGGATAGATCAAATTTTC
GATTTGGCATGATTCCGAATGAACCAAGAGCCTATGGTCTATGTGATTTCGAAGTTGATTTCAAAGACCGTCGAGCAGAA
CCACCAGCTAACCGTCAGGGTGATATTGCTAGAATTTATTTCTACATGCGAGATCAATACGGCCTAAGACTAAGCAGACA
ACAAACTCAGCTATTTGAAGCTTGGTCAAGAATGGACCCTGTTGATGAGTGGGAAAAATTACGTGATTTGAGGATTAGAG
GCATTCAAGGTAAGTCTAATTGCTATGTATCAGGCAGCTGCTAG

Domains


Predicted by InterproScan.

(41-224)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6G6TED8

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ideA Vibrio cholerae O1 str. 2010EL-1786

97.797

100

0.978

  dns Vibrio parahaemolyticus RIMD 2210633

51.965

100

0.524

  dns Aliivibrio fischeri ES114

51.304

100

0.52

  dns Vibrio cholerae strain A1552

50.667

99.119

0.502

  dns Campylobacter jejuni RM1221

38.393

98.678

0.379