Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   RDI66_RS03710 Genome accession   NZ_CP133492
Coordinates   767444..767893 (+) Length   149 a.a.
NCBI ID   WP_266199913.1    Uniprot ID   -
Organism   Pasteurella multocida strain PM140     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 728774..772720 767444..767893 within 0


Gene organization within MGE regions


Location: 728774..772720
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RDI66_RS03430 (RDI66_03430) - 728774..730021 (+) 1248 WP_079157839.1 tyrosine-type recombinase/integrase -
  RDI66_RS03435 (RDI66_03435) - 730047..730307 (-) 261 WP_079157838.1 DNA helicase UvrD -
  RDI66_RS03440 (RDI66_03440) - 730294..730884 (-) 591 WP_079157837.1 DUF4376 domain-containing protein -
  RDI66_RS03445 (RDI66_03445) - 730894..732651 (-) 1758 WP_170352179.1 pyocin knob domain-containing protein -
  RDI66_RS03450 (RDI66_03450) - 732663..736310 (-) 3648 WP_079157835.1 host specificity protein J -
  RDI66_RS03455 (RDI66_03455) - 736314..737033 (-) 720 WP_143932431.1 tail assembly protein -
  RDI66_RS03460 (RDI66_03460) - 736966..737679 (-) 714 WP_079157834.1 C40 family peptidase -
  RDI66_RS03465 (RDI66_03465) - 737681..738331 (-) 651 WP_078819812.1 phage minor tail protein L -
  RDI66_RS03470 (RDI66_03470) - 738375..738941 (-) 567 WP_078819667.1 hypothetical protein -
  RDI66_RS03475 (RDI66_03475) - 739013..739363 (-) 351 WP_005719622.1 phage tail protein -
  RDI66_RS03480 (RDI66_03480) - 739360..741753 (-) 2394 WP_099803047.1 phage tail length tape measure family protein -
  RDI66_RS03485 (RDI66_03485) - 741740..742045 (-) 306 WP_306556893.1 phage tail assembly protein T -
  RDI66_RS03490 (RDI66_03490) - 742063..742452 (-) 390 WP_014391488.1 phage minor tail protein G -
  RDI66_RS03495 (RDI66_03495) - 742455..742964 (-) 510 WP_014391487.1 phage tail tube protein -
  RDI66_RS03500 (RDI66_03500) gpU 742961..743368 (-) 408 WP_014391486.1 phage tail terminator protein -
  RDI66_RS03505 (RDI66_03505) - 743365..743916 (-) 552 WP_014391485.1 phage tail protein -
  RDI66_RS03510 (RDI66_03510) - 743916..744209 (-) 294 WP_014391484.1 hypothetical protein -
  RDI66_RS03515 (RDI66_03515) - 744202..744528 (-) 327 WP_005719720.1 DUF2190 family protein -
  RDI66_RS03520 (RDI66_03520) - 744600..746606 (-) 2007 WP_309042818.1 ClpP-like prohead protease/major capsid protein fusion protein -
  RDI66_RS03525 (RDI66_03525) - 746542..748080 (-) 1539 WP_099803045.1 phage portal protein -
  RDI66_RS03530 (RDI66_03530) - 748077..748298 (-) 222 WP_014391481.1 hypothetical protein -
  RDI66_RS03535 (RDI66_03535) - 748295..750403 (-) 2109 WP_014391480.1 phage terminase large subunit family protein -
  RDI66_RS03540 (RDI66_03540) - 750407..750880 (-) 474 WP_014391479.1 DUF1441 family protein -
  RDI66_RS03545 (RDI66_03545) - 751170..751430 (+) 261 WP_005720780.1 type II toxin-antitoxin system RelE/ParE family toxin -
  RDI66_RS03550 (RDI66_03550) - 751466..751834 (+) 369 WP_014391478.1 helix-turn-helix transcriptional regulator -
  RDI66_RS03555 (RDI66_03555) - 752044..752367 (-) 324 WP_014667795.1 DUF2570 family protein -
  RDI66_RS03560 (RDI66_03560) - 752340..752870 (-) 531 WP_078737811.1 lysozyme -
  RDI66_RS03565 (RDI66_03565) - 752867..753127 (-) 261 WP_014391475.1 HP1 family phage holin -
  RDI66_RS03575 (RDI66_03575) - 753454..753915 (-) 462 WP_014667792.1 antiterminator Q family protein -
  RDI66_RS03580 (RDI66_03580) - 753916..754518 (-) 603 WP_014390728.1 recombination protein NinG -
  RDI66_RS03585 (RDI66_03585) - 754511..754726 (-) 216 WP_014391472.1 hypothetical protein -
  RDI66_RS03590 (RDI66_03590) - 754800..755258 (-) 459 WP_014391471.1 recombination protein NinB -
  RDI66_RS03595 (RDI66_03595) - 755248..755784 (-) 537 WP_014391470.1 phage N-6-adenine-methyltransferase -
  RDI66_RS03600 (RDI66_03600) - 755788..756480 (-) 693 WP_014391469.1 replication protein P -
  RDI66_RS03605 (RDI66_03605) - 756477..757289 (-) 813 WP_014391468.1 replication protein -
  RDI66_RS03610 (RDI66_03610) - 757286..757969 (-) 684 WP_099868512.1 phage antirepressor KilAC domain-containing protein -
  RDI66_RS03615 (RDI66_03615) - 758030..758491 (-) 462 WP_078802159.1 phage regulatory CII family protein -
  RDI66_RS03620 (RDI66_03620) - 758541..758738 (-) 198 WP_014390719.1 helix-turn-helix domain-containing protein -
  RDI66_RS03625 (RDI66_03625) - 758862..759539 (+) 678 WP_014390718.1 XRE family transcriptional regulator -
  RDI66_RS03630 (RDI66_03630) - 759596..759991 (+) 396 WP_014391463.1 hypothetical protein -
  RDI66_RS03635 (RDI66_03635) - 759963..760487 (+) 525 WP_041423181.1 DUF2730 family protein -
  RDI66_RS03640 (RDI66_03640) - 760990..761220 (+) 231 WP_075271373.1 hypothetical protein -
  RDI66_RS03645 (RDI66_03645) - 761233..761403 (+) 171 WP_014391460.1 hypothetical protein -
  RDI66_RS03650 (RDI66_03650) - 761384..761578 (-) 195 WP_014391459.1 hypothetical protein -
  RDI66_RS03655 (RDI66_03655) - 761875..762063 (+) 189 WP_014391458.1 hypothetical protein -
  RDI66_RS03660 (RDI66_03660) - 762056..762328 (-) 273 WP_014391457.1 hypothetical protein -
  RDI66_RS03665 (RDI66_03665) - 762513..762776 (+) 264 WP_014391456.1 hypothetical protein -
  RDI66_RS03670 (RDI66_03670) - 762863..763660 (+) 798 WP_099821951.1 hypothetical protein -
  RDI66_RS03675 (RDI66_03675) - 763988..764596 (+) 609 WP_170352215.1 BRO family protein -
  RDI66_RS03680 (RDI66_03680) - 764658..764888 (-) 231 WP_223251317.1 hypothetical protein -
  RDI66_RS03685 (RDI66_03685) - 765036..765335 (+) 300 WP_014390709.1 hypothetical protein -
  RDI66_RS03690 (RDI66_03690) - 765307..765543 (+) 237 WP_170452858.1 hypothetical protein -
  RDI66_RS03695 (RDI66_03695) - 765556..765843 (+) 288 WP_014391452.1 hypothetical protein -
  RDI66_RS03700 (RDI66_03700) - 765845..766798 (+) 954 WP_014391451.1 recombinase RecT -
  RDI66_RS03705 (RDI66_03705) - 766770..767444 (+) 675 WP_015691053.1 translocation protein TolB precursor -
  RDI66_RS03710 (RDI66_03710) ssb 767444..767893 (+) 450 WP_266199913.1 single-stranded DNA-binding protein Machinery gene
  RDI66_RS03715 (RDI66_03715) rdgC 768031..768933 (+) 903 WP_014390699.1 recombination-associated protein RdgC -
  RDI66_RS03720 (RDI66_03720) - 768974..769462 (+) 489 WP_014390698.1 DUF551 domain-containing protein -
  RDI66_RS03725 (RDI66_03725) - 769471..769827 (+) 357 WP_015691049.1 hypothetical protein -
  RDI66_RS03730 (RDI66_03730) - 769931..770839 (+) 909 WP_015691048.1 P63C domain-containing protein -
  RDI66_RS03735 (RDI66_03735) - 771078..771713 (+) 636 WP_014391104.1 Bro-N domain-containing protein -
  RDI66_RS03740 (RDI66_03740) - 771771..771968 (+) 198 WP_014391107.1 AlpA family transcriptional regulator -
  RDI66_RS03745 (RDI66_03745) - 772511..772720 (-) 210 WP_005716039.1 cold-shock protein -

Sequence

Protein


Download         Length: 149 a.a.        Molecular weight: 17024.90 Da        Isoelectric Point: 6.9835

>NTDB_id=874771 RDI66_RS03710 WP_266199913.1 767444..767893(+) (ssb) [Pasteurella multocida strain PM140]
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKSGKPVQKFDNFEEDDIPF

Nucleotide


Download         Length: 450 bp        

>NTDB_id=874771 RDI66_RS03710 WP_266199913.1 767444..767893(+) (ssb) [Pasteurella multocida strain PM140]
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAAGTGGAA
AACCAGTGCAGAAGTTTGATAATTTTGAAGAAGACGATATACCGTTTTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

61.878

100

0.752
  ssb Vibrio cholerae strain A1552

52.518

93.289

0.49
  ssb Neisseria meningitidis MC58

39.548

100

0.47
  ssb Neisseria gonorrhoeae MS11

43.796

91.946

0.403