Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   HSX42_RS19155 Genome accession   NZ_CP133461
Coordinates   3739897..3740391 (-) Length   164 a.a.
NCBI ID   WP_011888458.1    Uniprot ID   A0A0Q0YUR8
Organism   Geobacillus thermodenitrificans strain K1041     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3700485..3748810 3739897..3740391 within 0


Gene organization within MGE regions


Location: 3700485..3748810
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HSX42_RS18965 (HSX42_18965) - 3700485..3701030 (+) 546 WP_008880794.1 hypothetical protein -
  HSX42_RS18970 (HSX42_18970) - 3701173..3701877 (-) 705 WP_011888445.1 polysaccharide deacetylase family protein -
  HSX42_RS18975 (HSX42_18975) - 3702079..3703746 (+) 1668 WP_172437884.1 IS1634 family transposase -
  HSX42_RS19320 - 3703879..3704358 (+) 480 WP_366664337.1 monodechloroaminopyrrolnitrin synthase PrnB family protein -
  HSX42_RS19325 - 3705593..3705913 (+) 321 WP_375338916.1 monodechloroaminopyrrolnitrin synthase PrnB family protein -
  HSX42_RS18985 (HSX42_18985) - 3706058..3706858 (-) 801 WP_011230382.1 ExeA family protein -
  HSX42_RS18990 (HSX42_18990) - 3706851..3708104 (-) 1254 WP_021292743.1 IS481 family transposase -
  HSX42_RS18995 (HSX42_18995) - 3708245..3708802 (-) 558 WP_042412494.1 DUF6431 domain-containing protein -
  HSX42_RS19000 (HSX42_19000) - 3709171..3710244 (+) 1074 WP_087960353.1 MFS transporter -
  HSX42_RS19005 (HSX42_19005) - 3710254..3710827 (-) 574 Protein_3689 IS630-like element ISBs2 family transposase -
  HSX42_RS19015 (HSX42_19015) - 3712114..3712602 (-) 489 Protein_3691 IS630 family transposase -
  HSX42_RS19020 (HSX42_19020) - 3713103..3714017 (+) 915 WP_081157674.1 tyrosine-type recombinase/integrase -
  HSX42_RS19025 (HSX42_19025) - 3714056..3714313 (+) 258 WP_081157675.1 hypothetical protein -
  HSX42_RS19030 (HSX42_19030) - 3714467..3715345 (-) 879 WP_087960355.1 IS982-like element ISGth1 family transposase -
  HSX42_RS19035 (HSX42_19035) - 3715507..3716652 (-) 1146 WP_081157635.1 ABC transporter permease -
  HSX42_RS19040 (HSX42_19040) - 3716654..3717775 (-) 1122 WP_081157636.1 ABC transporter permease -
  HSX42_RS19045 (HSX42_19045) - 3717802..3718737 (-) 936 WP_087960356.1 ABC transporter ATP-binding protein -
  HSX42_RS19050 (HSX42_19050) - 3718856..3719962 (-) 1107 WP_087960357.1 sensor histidine kinase -
  HSX42_RS19055 (HSX42_19055) - 3719972..3720610 (-) 639 WP_081157660.1 response regulator transcription factor -
  HSX42_RS19060 (HSX42_19060) - 3720851..3721108 (-) 258 WP_081157658.1 DUF3949 domain-containing protein -
  HSX42_RS19065 (HSX42_19065) - 3721235..3721495 (+) 261 WP_081157659.1 NUDIX hydrolase -
  HSX42_RS19070 (HSX42_19070) - 3721759..3722637 (-) 879 WP_236934158.1 IS982 family transposase -
  HSX42_RS19080 (HSX42_19080) rlmH 3723933..3724412 (-) 480 WP_041264774.1 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH -
  HSX42_RS19085 (HSX42_19085) - 3724496..3724645 (-) 150 WP_008880799.1 CxxH/CxxC protein -
  HSX42_RS19090 (HSX42_19090) - 3724712..3725929 (-) 1218 WP_035499498.1 S1C family serine protease -
  HSX42_RS19095 (HSX42_19095) - 3726031..3726825 (-) 795 WP_008880801.1 MBL fold metallo-hydrolase -
  HSX42_RS19100 (HSX42_19100) - 3726832..3727614 (-) 783 WP_008880802.1 two-component system regulatory protein YycI -
  HSX42_RS19105 (HSX42_19105) - 3727601..3728929 (-) 1329 WP_087960359.1 YycH family regulatory protein -
  HSX42_RS19110 (HSX42_19110) walK 3728922..3730751 (-) 1830 WP_087960360.1 cell wall metabolism sensor histidine kinase WalK -
  HSX42_RS19115 (HSX42_19115) yycF 3730758..3731471 (-) 714 WP_008880805.1 response regulator YycF -
  HSX42_RS19120 (HSX42_19120) - 3731696..3732982 (-) 1287 WP_008880807.1 adenylosuccinate synthase -
  HSX42_RS19125 (HSX42_19125) - 3733196..3734733 (+) 1538 Protein_3713 IS1182 family transposase -
  HSX42_RS19130 (HSX42_19130) dnaB 3734689..3736053 (-) 1365 WP_008880808.1 replicative DNA helicase -
  HSX42_RS19135 (HSX42_19135) rplI 3736148..3736597 (-) 450 WP_011888453.1 50S ribosomal protein L9 -
  HSX42_RS19140 (HSX42_19140) - 3736594..3738570 (-) 1977 WP_029761080.1 DHH family phosphoesterase -
  HSX42_RS19145 (HSX42_19145) - 3738617..3739543 (-) 927 WP_008880811.1 YybS family protein -
  HSX42_RS19150 (HSX42_19150) rpsR 3739621..3739857 (-) 237 WP_008880812.1 30S ribosomal protein S18 -
  HSX42_RS19155 (HSX42_19155) ssbA 3739897..3740391 (-) 495 WP_011888458.1 single-stranded DNA-binding protein Machinery gene
  HSX42_RS19160 (HSX42_19160) rpsF 3740421..3740708 (-) 288 WP_008880815.1 30S ribosomal protein S6 -
  HSX42_RS19165 (HSX42_19165) ychF 3740934..3742034 (-) 1101 WP_008880816.1 redox-regulated ATPase YchF -
  HSX42_RS19170 (HSX42_19170) - 3742134..3743410 (-) 1277 Protein_3722 molybdopterin-dependent oxidoreductase -
  HSX42_RS19175 (HSX42_19175) - 3743477..3743674 (-) 198 WP_008880819.1 DUF951 domain-containing protein -
  HSX42_RS19180 (HSX42_19180) - 3743693..3744592 (-) 900 WP_029761078.1 mechanosensitive ion channel family protein -
  HSX42_RS19185 (HSX42_19185) yyaC 3744766..3745389 (+) 624 WP_008880821.1 spore protease YyaC -
  HSX42_RS19190 (HSX42_19190) - 3745473..3746174 (-) 702 WP_008880822.1 DUF554 domain-containing protein -
  HSX42_RS19195 (HSX42_19195) - 3746226..3747086 (-) 861 WP_008880823.1 ParB/RepB/Spo0J family partition protein -
  HSX42_RS19200 (HSX42_19200) - 3747079..3747840 (-) 762 WP_008880824.1 ParA family protein -
  HSX42_RS19205 (HSX42_19205) noc 3747965..3748810 (-) 846 WP_087960361.1 nucleoid occlusion protein -

Sequence


Protein


Download         Length: 164 a.a.        Molecular weight: 18394.33 Da        Isoelectric Point: 4.7055

>NTDB_id=874368 HSX42_RS19155 WP_011888458.1 3739897..3740391(-) (ssbA) [Geobacillus thermodenitrificans strain K1041]
MINRVILVGRLTRDPELRYTPSGVAVATFTLAVNRPFTNQQGEREADFIQCVVWRRQAENVANFLKKGSLAGVDGRLQTR
SYENQEGRRVYVTEVVADNVQFLEPKGSNEQRGAAAGGYYGDPFPFGQDQNHRYPNEKGIGRIDEDPFANDGQPIDISDD
DLPF

Nucleotide


Download         Length: 495 bp        

>NTDB_id=874368 HSX42_RS19155 WP_011888458.1 3739897..3740391(-) (ssbA) [Geobacillus thermodenitrificans strain K1041]
ATGATTAACCGCGTCATTTTGGTCGGCAGGTTAACGAGAGATCCGGAGTTGCGCTACACTCCAAGCGGAGTGGCTGTTGC
CACATTTACGCTCGCGGTCAACCGCCCGTTCACAAACCAGCAGGGCGAGCGTGAAGCTGATTTTATCCAATGTGTTGTTT
GGCGTCGCCAGGCAGAAAACGTCGCTAACTTCTTAAAAAAAGGAAGCTTAGCCGGAGTGGACGGCCGGCTGCAAACTCGC
AGCTATGAAAACCAAGAAGGCCGGCGCGTGTATGTGACGGAAGTGGTGGCTGATAACGTCCAATTTCTTGAGCCAAAAGG
AAGCAACGAGCAACGTGGGGCAGCAGCAGGCGGCTACTATGGGGATCCGTTCCCATTCGGACAAGATCAGAACCACCGAT
ACCCGAACGAAAAAGGGATTGGCCGCATTGATGAAGATCCTTTCGCCAATGACGGCCAACCGATCGATATTTCTGACGAC
GATTTGCCGTTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0Q0YUR8

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

68

100

0.726

  ssb Latilactobacillus sakei subsp. sakei 23K

60.588

100

0.628

  ssbB Bacillus subtilis subsp. subtilis str. 168

64.151

64.634

0.415

  ssb Glaesserella parasuis strain SC1401

33.898

100

0.366