Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RDU00_RS16005 Genome accession   NZ_CP133449
Coordinates   3012618..3012758 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain KK195     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3007618..3017758
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RDU00_RS15980 (RDU00_15970) yuxO 3007931..3008311 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  RDU00_RS15985 (RDU00_15975) comA 3008330..3008974 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  RDU00_RS15990 (RDU00_15980) comP 3009055..3011364 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  RDU00_RS15995 (RDU00_15985) comX 3011379..3011546 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  RDU00_RS16000 (RDU00_15990) comQ 3011534..3012433 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  RDU00_RS16005 (RDU00_15995) degQ 3012618..3012758 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  RDU00_RS16010 (RDU00_16000) - 3012980..3013105 (+) 126 WP_003228793.1 hypothetical protein -
  RDU00_RS16015 (RDU00_16005) - 3013219..3013587 (+) 369 WP_003243784.1 hypothetical protein -
  RDU00_RS16020 (RDU00_16010) pdeH 3013563..3014792 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  RDU00_RS16025 (RDU00_16015) pncB 3014929..3016401 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  RDU00_RS16030 (RDU00_16020) pncA 3016417..3016968 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  RDU00_RS16035 (RDU00_16025) yueI 3017065..3017463 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=874242 RDU00_RS16005 WP_003220708.1 3012618..3012758(-) (degQ) [Bacillus subtilis strain KK195]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=874242 RDU00_RS16005 WP_003220708.1 3012618..3012758(-) (degQ) [Bacillus subtilis strain KK195]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1