Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   RDU00_RS15995 Genome accession   NZ_CP133449
Coordinates   3011379..3011546 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain KK195     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3006379..3016546
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RDU00_RS15965 (RDU00_15955) mrpE 3006774..3007250 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  RDU00_RS15970 (RDU00_15960) mrpF 3007250..3007534 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  RDU00_RS15975 (RDU00_15965) mnhG 3007518..3007892 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  RDU00_RS15980 (RDU00_15970) yuxO 3007931..3008311 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  RDU00_RS15985 (RDU00_15975) comA 3008330..3008974 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  RDU00_RS15990 (RDU00_15980) comP 3009055..3011364 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  RDU00_RS15995 (RDU00_15985) comX 3011379..3011546 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  RDU00_RS16000 (RDU00_15990) comQ 3011534..3012433 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  RDU00_RS16005 (RDU00_15995) degQ 3012618..3012758 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  RDU00_RS16010 (RDU00_16000) - 3012980..3013105 (+) 126 WP_003228793.1 hypothetical protein -
  RDU00_RS16015 (RDU00_16005) - 3013219..3013587 (+) 369 WP_003243784.1 hypothetical protein -
  RDU00_RS16020 (RDU00_16010) pdeH 3013563..3014792 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  RDU00_RS16025 (RDU00_16015) pncB 3014929..3016401 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=874240 RDU00_RS15995 WP_003242801.1 3011379..3011546(-) (comX) [Bacillus subtilis strain KK195]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=874240 RDU00_RS15995 WP_003242801.1 3011379..3011546(-) (comX) [Bacillus subtilis strain KK195]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1