Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   RA292_RS11815 Genome accession   NZ_CP132912
Coordinates   2329644..2330018 (-) Length   124 a.a.
NCBI ID   WP_003230170.1    Uniprot ID   A0AAE2SIW8
Organism   Bacillus subtilis subsp. natto strain BN-P15-11-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2324644..2335018
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RA292_RS11775 yqhG 2324976..2325770 (+) 795 WP_003230200.1 YqhG family protein -
  RA292_RS11780 sinI 2325953..2326126 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  RA292_RS11785 sinR 2326160..2326495 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RA292_RS11790 tasA 2326588..2327373 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  RA292_RS11795 sipW 2327437..2328009 (-) 573 WP_003230181.1 signal peptidase I SipW -
  RA292_RS11800 tapA 2327993..2328754 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  RA292_RS11805 yqzG 2329026..2329352 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  RA292_RS11810 spoIITA 2329394..2329573 (-) 180 WP_003230176.1 YqzE family protein -
  RA292_RS11815 comGG 2329644..2330018 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  RA292_RS11820 comGF 2330019..2330402 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  RA292_RS11825 comGE 2330428..2330775 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  RA292_RS11830 comGD 2330759..2331190 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  RA292_RS11835 comGC 2331180..2331476 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  RA292_RS11840 comGB 2331490..2332527 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  RA292_RS11845 comGA 2332514..2333584 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  RA292_RS11850 - 2333795..2333920 (-) 126 WP_003230155.1 hypothetical protein -
  RA292_RS11855 corA 2333986..2334939 (-) 954 WP_032677123.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14539.79 Da        Isoelectric Point: 9.2806

>NTDB_id=870650 RA292_RS11815 WP_003230170.1 2329644..2330018(-) (comGG) [Bacillus subtilis subsp. natto strain BN-P15-11-1]
MYRTRGFIYPAVLFVSALVLLIVNFVAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFLYGRVS
YYIHDTSIKEQKEINLRVSTDSGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=870650 RA292_RS11815 WP_003230170.1 2329644..2330018(-) (comGG) [Bacillus subtilis subsp. natto strain BN-P15-11-1]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGTTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCTATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGATTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

100

100

1