Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   RA292_RS11780 Genome accession   NZ_CP132912
Coordinates   2325953..2326126 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. natto strain BN-P15-11-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2320953..2331126
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RA292_RS11765 gcvT 2321752..2322840 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  RA292_RS11770 hepAA 2323282..2324955 (+) 1674 WP_003230203.1 DEAD/DEAH box helicase -
  RA292_RS11775 yqhG 2324976..2325770 (+) 795 WP_003230200.1 YqhG family protein -
  RA292_RS11780 sinI 2325953..2326126 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  RA292_RS11785 sinR 2326160..2326495 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RA292_RS11790 tasA 2326588..2327373 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  RA292_RS11795 sipW 2327437..2328009 (-) 573 WP_003230181.1 signal peptidase I SipW -
  RA292_RS11800 tapA 2327993..2328754 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  RA292_RS11805 yqzG 2329026..2329352 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  RA292_RS11810 spoIITA 2329394..2329573 (-) 180 WP_003230176.1 YqzE family protein -
  RA292_RS11815 comGG 2329644..2330018 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  RA292_RS11820 comGF 2330019..2330402 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  RA292_RS11825 comGE 2330428..2330775 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=870648 RA292_RS11780 WP_003230187.1 2325953..2326126(+) (sinI) [Bacillus subtilis subsp. natto strain BN-P15-11-1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=870648 RA292_RS11780 WP_003230187.1 2325953..2326126(+) (sinI) [Bacillus subtilis subsp. natto strain BN-P15-11-1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1