Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | RA306_RS12030 | Genome accession | NZ_CP132898 |
| Coordinates | 2403096..2403524 (-) | Length | 142 a.a. |
| NCBI ID | WP_016569994.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain P1933 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2390044..2442077 | 2403096..2403524 | within | 0 |
Gene organization within MGE regions
Location: 2390044..2442077
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RA306_RS11945 (RA306_11955) | metN | 2390044..2391078 (-) | 1035 | WP_015702670.1 | methionine ABC transporter ATP-binding protein MetN | - |
| RA306_RS11950 (RA306_11960) | gmhB | 2391271..2391825 (+) | 555 | WP_005755313.1 | D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase | - |
| RA306_RS11990 (RA306_12000) | - | 2397686..2398774 (-) | 1089 | WP_042743210.1 | site-specific integrase | - |
| RA306_RS11995 (RA306_12005) | - | 2398817..2398981 (-) | 165 | WP_306610786.1 | helix-turn-helix domain-containing protein | - |
| RA306_RS12000 (RA306_12010) | - | 2399171..2399848 (-) | 678 | WP_016570001.1 | BRO family protein | - |
| RA306_RS12005 (RA306_12015) | - | 2400103..2400429 (-) | 327 | WP_306610787.1 | DUF551 domain-containing protein | - |
| RA306_RS13250 | - | 2400602..2400814 (-) | 213 | WP_080637896.1 | DUF551 domain-containing protein | - |
| RA306_RS12010 (RA306_12020) | - | 2400802..2401167 (-) | 366 | WP_016533502.1 | hypothetical protein | - |
| RA306_RS12015 (RA306_12025) | - | 2401164..2401763 (-) | 600 | WP_016569996.1 | hypothetical protein | - |
| RA306_RS12020 (RA306_12030) | - | 2401816..2402604 (-) | 789 | WP_014391448.1 | DUF2303 family protein | - |
| RA306_RS12025 (RA306_12035) | - | 2402729..2403034 (-) | 306 | WP_016569995.1 | hypothetical protein | - |
| RA306_RS12030 (RA306_12040) | ssb | 2403096..2403524 (-) | 429 | WP_016569994.1 | single-stranded DNA-binding protein | Machinery gene |
| RA306_RS12035 (RA306_12045) | - | 2403535..2404236 (-) | 702 | WP_016533472.1 | ERF family protein | - |
| RA306_RS12040 (RA306_12050) | - | 2404279..2404923 (-) | 645 | WP_016533471.1 | ribonuclease H-like domain-containing protein | - |
| RA306_RS12045 (RA306_12055) | - | 2405097..2405258 (-) | 162 | WP_016569992.1 | hypothetical protein | - |
| RA306_RS12050 (RA306_12060) | - | 2405271..2405507 (-) | 237 | WP_016569991.1 | hypothetical protein | - |
| RA306_RS12055 (RA306_12065) | - | 2405479..2405778 (-) | 300 | WP_014391453.1 | hypothetical protein | - |
| RA306_RS12060 (RA306_12070) | - | 2405926..2406156 (+) | 231 | WP_223251317.1 | hypothetical protein | - |
| RA306_RS12065 (RA306_12075) | - | 2406218..2406865 (-) | 648 | WP_016570070.1 | Bro-N domain-containing protein | - |
| RA306_RS12070 (RA306_12080) | - | 2407131..2407676 (-) | 546 | WP_016533491.1 | hypothetical protein | - |
| RA306_RS12075 (RA306_12085) | - | 2407815..2407943 (-) | 129 | WP_023430120.1 | KilA-N domain-containing protein | - |
| RA306_RS12080 (RA306_12090) | - | 2408268..2408498 (-) | 231 | WP_016533507.1 | hypothetical protein | - |
| RA306_RS12085 (RA306_12095) | - | 2409120..2409944 (-) | 825 | WP_014390716.1 | DUF3037 domain-containing protein | - |
| RA306_RS12090 (RA306_12100) | - | 2409941..2410678 (-) | 738 | WP_016533466.1 | HipA family kinase | - |
| RA306_RS12095 (RA306_12105) | - | 2410761..2411444 (-) | 684 | WP_042743225.1 | S24 family peptidase | - |
| RA306_RS12100 (RA306_12110) | - | 2411568..2411768 (+) | 201 | WP_016533493.1 | YdaS family helix-turn-helix protein | - |
| RA306_RS12105 (RA306_12115) | - | 2411817..2412266 (+) | 450 | WP_016533494.1 | YmfL family putative regulatory protein | - |
| RA306_RS12110 (RA306_12120) | - | 2412324..2412504 (+) | 181 | Protein_2355 | hypothetical protein | - |
| RA306_RS12115 (RA306_12125) | - | 2412581..2412934 (+) | 354 | WP_014390722.1 | HNH endonuclease | - |
| RA306_RS12120 (RA306_12130) | - | 2412936..2413838 (+) | 903 | WP_016533442.1 | hypothetical protein | - |
| RA306_RS12125 (RA306_12135) | - | 2413838..2414527 (+) | 690 | WP_016533441.1 | replication protein P | - |
| RA306_RS12130 (RA306_12140) | - | 2414531..2415067 (+) | 537 | WP_014391470.1 | phage N-6-adenine-methyltransferase | - |
| RA306_RS12135 (RA306_12145) | - | 2415057..2415515 (+) | 459 | WP_016569985.1 | recombination protein NinB | - |
| RA306_RS12140 (RA306_12150) | - | 2415589..2415801 (+) | 213 | WP_016533468.1 | hypothetical protein | - |
| RA306_RS12145 (RA306_12155) | - | 2415889..2416491 (+) | 603 | WP_016533469.1 | recombination protein NinG | - |
| RA306_RS12150 (RA306_12160) | - | 2416491..2416856 (+) | 366 | WP_016533470.1 | antiterminator Q family protein | - |
| RA306_RS12155 (RA306_12165) | - | 2417046..2417231 (+) | 186 | WP_143930513.1 | hypothetical protein | - |
| RA306_RS12160 (RA306_12170) | - | 2417445..2417810 (+) | 366 | WP_016533461.1 | phage holin, lambda family | - |
| RA306_RS12165 (RA306_12175) | - | 2417782..2418366 (+) | 585 | WP_016533462.1 | glycoside hydrolase family 19 protein | - |
| RA306_RS12170 (RA306_12180) | - | 2418369..2418692 (+) | 324 | WP_016569983.1 | DUF2570 family protein | - |
| RA306_RS12175 (RA306_12185) | - | 2418670..2418879 (+) | 210 | WP_023430090.1 | hypothetical protein | - |
| RA306_RS12180 (RA306_12190) | - | 2418914..2419348 (-) | 435 | WP_014390736.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| RA306_RS12185 (RA306_12195) | - | 2419377..2419559 (-) | 183 | WP_016533497.1 | type II toxin-antitoxin system HicA family toxin | - |
| RA306_RS12190 (RA306_12200) | - | 2419642..2420139 (+) | 498 | WP_014390737.1 | terminase | - |
| RA306_RS12195 (RA306_12205) | - | 2420123..2421349 (+) | 1227 | WP_016533292.1 | PBSX family phage terminase large subunit | - |
| RA306_RS12200 (RA306_12210) | - | 2421364..2422809 (+) | 1446 | WP_016533291.1 | anti-CBASS protein Acb1 family protein | - |
| RA306_RS12205 (RA306_12215) | - | 2422763..2423734 (+) | 972 | WP_014390740.1 | phage minor head protein | - |
| RA306_RS12210 (RA306_12220) | - | 2423749..2425095 (+) | 1347 | WP_016533290.1 | hypothetical protein | - |
| RA306_RS12215 (RA306_12225) | - | 2425095..2425529 (+) | 435 | WP_016533289.1 | hypothetical protein | - |
| RA306_RS12220 (RA306_12230) | - | 2425541..2426539 (+) | 999 | WP_016533288.1 | major capsid protein | - |
| RA306_RS12225 (RA306_12235) | - | 2426550..2427251 (+) | 702 | WP_306610788.1 | hypothetical protein | - |
| RA306_RS12230 (RA306_12240) | - | 2427232..2427600 (+) | 369 | WP_042743192.1 | hypothetical protein | - |
| RA306_RS12235 (RA306_12245) | - | 2427603..2427947 (+) | 345 | WP_014390746.1 | hypothetical protein | - |
| RA306_RS12240 (RA306_12250) | - | 2427952..2428323 (+) | 372 | WP_014390747.1 | hypothetical protein | - |
| RA306_RS12245 (RA306_12255) | - | 2428320..2428691 (+) | 372 | WP_016533319.1 | hypothetical protein | - |
| RA306_RS12250 (RA306_12260) | - | 2428703..2429185 (+) | 483 | WP_014390749.1 | phage tail tube protein | - |
| RA306_RS12255 (RA306_12265) | - | 2429239..2429910 (+) | 672 | WP_016533320.1 | DUF6246 family protein | - |
| RA306_RS12260 (RA306_12270) | - | 2429941..2430405 (+) | 465 | WP_016533321.1 | hypothetical protein | - |
| RA306_RS12265 (RA306_12275) | - | 2430473..2430868 (+) | 396 | WP_016533322.1 | hypothetical protein | - |
| RA306_RS12270 (RA306_12280) | - | 2430927..2433371 (+) | 2445 | WP_042743193.1 | phage tail length tape measure family protein | - |
| RA306_RS12275 (RA306_12285) | - | 2433374..2433703 (+) | 330 | WP_014390756.1 | phage tail protein | - |
| RA306_RS12280 (RA306_12290) | - | 2433793..2434506 (+) | 714 | WP_023430089.1 | phage minor tail protein L | - |
| RA306_RS12285 (RA306_12295) | - | 2434511..2435254 (+) | 744 | WP_016569980.1 | C40 family peptidase | - |
| RA306_RS12290 (RA306_12300) | - | 2435197..2435817 (+) | 621 | WP_014667799.1 | tail assembly protein | - |
| RA306_RS12295 (RA306_12305) | - | 2435821..2441706 (+) | 5886 | WP_158635219.1 | phage tail protein | - |
| RA306_RS12300 (RA306_12310) | - | 2441754..2442077 (+) | 324 | WP_016569978.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15776.74 Da Isoelectric Point: 8.0053
>NTDB_id=870506 RA306_RS12030 WP_016569994.1 2403096..2403524(-) (ssb) [Pasteurella multocida strain P1933]
MAGVNKVIIVGNLGQNPDYKVMTNGDPVTNISVATSEVWADKASGEKREVVEWHRITIYRRQADIAAQFLKKGSKVYVEG
RLKTRKWQDQSGQERYITEILADKIVLLDSKQSASAGNGSPPPAQQQHDPYGDAFNCDNIPF
MAGVNKVIIVGNLGQNPDYKVMTNGDPVTNISVATSEVWADKASGEKREVVEWHRITIYRRQADIAAQFLKKGSKVYVEG
RLKTRKWQDQSGQERYITEILADKIVLLDSKQSASAGNGSPPPAQQQHDPYGDAFNCDNIPF
Nucleotide
Download Length: 429 bp
>NTDB_id=870506 RA306_RS12030 WP_016569994.1 2403096..2403524(-) (ssb) [Pasteurella multocida strain P1933]
ATGGCTGGAGTAAATAAAGTAATTATTGTTGGCAACTTAGGGCAAAACCCCGATTACAAAGTAATGACAAATGGCGATCC
CGTGACCAACATCAGCGTGGCTACAAGTGAAGTGTGGGCTGATAAAGCAAGCGGTGAAAAGCGCGAAGTTGTCGAGTGGC
ACCGTATTACGATATATCGCAGACAAGCGGACATTGCCGCACAATTTTTGAAAAAAGGTTCTAAAGTCTATGTTGAAGGT
CGTTTAAAAACTCGTAAATGGCAAGATCAAAGCGGACAAGAACGATACATCACAGAAATTCTCGCTGATAAGATCGTCTT
ACTTGATAGCAAGCAGAGTGCGAGTGCTGGCAATGGCAGTCCACCACCAGCACAACAGCAACATGATCCGTATGGTGACG
CATTTAATTGTGACAATATTCCATTCTGA
ATGGCTGGAGTAAATAAAGTAATTATTGTTGGCAACTTAGGGCAAAACCCCGATTACAAAGTAATGACAAATGGCGATCC
CGTGACCAACATCAGCGTGGCTACAAGTGAAGTGTGGGCTGATAAAGCAAGCGGTGAAAAGCGCGAAGTTGTCGAGTGGC
ACCGTATTACGATATATCGCAGACAAGCGGACATTGCCGCACAATTTTTGAAAAAAGGTTCTAAAGTCTATGTTGAAGGT
CGTTTAAAAACTCGTAAATGGCAAGATCAAAGCGGACAAGAACGATACATCACAGAAATTCTCGCTGATAAGATCGTCTT
ACTTGATAGCAAGCAGAGTGCGAGTGCTGGCAATGGCAGTCCACCACCAGCACAACAGCAACATGATCCGTATGGTGACG
CATTTAATTGTGACAATATTCCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
67.544 |
80.282 |
0.542 |
| ssb | Neisseria meningitidis MC58 |
42.958 |
100 |
0.43 |
| ssb | Neisseria gonorrhoeae MS11 |
42.958 |
100 |
0.43 |
| ssb | Vibrio cholerae strain A1552 |
59.596 |
69.718 |
0.415 |