Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | RA306_RS07605 | Genome accession | NZ_CP132898 |
| Coordinates | 1541810..1542274 (-) | Length | 154 a.a. |
| NCBI ID | WP_016570065.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain P1933 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1536604..1581137 | 1541810..1542274 | within | 0 |
Gene organization within MGE regions
Location: 1536604..1581137
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RA306_RS07560 (RA306_07555) | - | 1536604..1537641 (-) | 1038 | WP_016533424.1 | tyrosine-type recombinase/integrase | - |
| RA306_RS07565 (RA306_07560) | - | 1537650..1538021 (-) | 372 | WP_223251315.1 | hypothetical protein | - |
| RA306_RS07570 (RA306_07565) | - | 1538152..1538637 (-) | 486 | WP_016533426.1 | hypothetical protein | - |
| RA306_RS07575 (RA306_07570) | - | 1538723..1539022 (-) | 300 | WP_016533427.1 | hypothetical protein | - |
| RA306_RS07580 (RA306_07575) | - | 1539032..1539565 (-) | 534 | WP_016570062.1 | DUF551 domain-containing protein | - |
| RA306_RS07585 (RA306_07580) | - | 1539700..1540299 (-) | 600 | WP_014391447.1 | hypothetical protein | - |
| RA306_RS07590 (RA306_07585) | - | 1540350..1541138 (-) | 789 | WP_014391448.1 | DUF2303 family protein | - |
| RA306_RS07595 (RA306_07590) | - | 1541211..1541564 (-) | 354 | WP_016570064.1 | hypothetical protein | - |
| RA306_RS07600 (RA306_07595) | - | 1541607..1541798 (-) | 192 | WP_016533530.1 | hypothetical protein | - |
| RA306_RS07605 (RA306_07600) | ssb | 1541810..1542274 (-) | 465 | WP_016570065.1 | single-stranded DNA-binding protein | Machinery gene |
| RA306_RS07610 (RA306_07605) | - | 1542278..1542889 (-) | 612 | WP_064775601.1 | YqaJ viral recombinase family protein | - |
| RA306_RS07615 (RA306_07610) | bet | 1542882..1543733 (-) | 852 | WP_016533454.1 | phage recombination protein Bet | - |
| RA306_RS07620 (RA306_07615) | - | 1543737..1544717 (-) | 981 | WP_101766859.1 | hypothetical protein | - |
| RA306_RS07625 (RA306_07620) | - | 1544720..1544881 (-) | 162 | WP_014390707.1 | hypothetical protein | - |
| RA306_RS07630 (RA306_07625) | - | 1544895..1545131 (-) | 237 | WP_016570068.1 | hypothetical protein | - |
| RA306_RS07635 (RA306_07630) | - | 1545118..1545402 (-) | 285 | WP_016570069.1 | hypothetical protein | - |
| RA306_RS07640 (RA306_07635) | - | 1545550..1545780 (+) | 231 | WP_223251317.1 | hypothetical protein | - |
| RA306_RS07645 (RA306_07640) | - | 1545842..1546477 (-) | 636 | WP_016569990.1 | Bro-N domain-containing protein | - |
| RA306_RS07650 (RA306_07645) | - | 1546813..1546938 (+) | 126 | WP_014391103.1 | hypothetical protein | - |
| RA306_RS07655 (RA306_07650) | - | 1546939..1547472 (-) | 534 | WP_014391102.1 | hypothetical protein | - |
| RA306_RS07660 (RA306_07655) | - | 1547560..1547823 (-) | 264 | WP_014391456.1 | hypothetical protein | - |
| RA306_RS07665 (RA306_07660) | - | 1548048..1548278 (-) | 231 | WP_016533507.1 | hypothetical protein | - |
| RA306_RS07670 (RA306_07665) | - | 1548889..1549272 (-) | 384 | WP_016533476.1 | hypothetical protein | - |
| RA306_RS07675 (RA306_07670) | - | 1549269..1549748 (-) | 480 | WP_016533477.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| RA306_RS07680 (RA306_07675) | - | 1549751..1550014 (-) | 264 | WP_016533478.1 | type II toxin-antitoxin system HicA family toxin | - |
| RA306_RS07685 (RA306_07680) | - | 1550197..1550865 (-) | 669 | WP_016533485.1 | XRE family transcriptional regulator | - |
| RA306_RS07690 (RA306_07685) | - | 1550989..1551186 (+) | 198 | WP_014390719.1 | helix-turn-helix domain-containing protein | - |
| RA306_RS07695 (RA306_07690) | - | 1551259..1551687 (+) | 429 | WP_228503802.1 | phage regulatory CII family protein | - |
| RA306_RS07700 (RA306_07695) | - | 1551746..1552447 (+) | 702 | WP_075266301.1 | phage antirepressor KilAC domain-containing protein | - |
| RA306_RS07705 (RA306_07700) | - | 1552444..1552797 (+) | 354 | WP_014390722.1 | HNH endonuclease | - |
| RA306_RS07710 (RA306_07705) | - | 1552799..1553701 (+) | 903 | WP_016533442.1 | hypothetical protein | - |
| RA306_RS07715 (RA306_07710) | - | 1553701..1554390 (+) | 690 | WP_016533441.1 | replication protein P | - |
| RA306_RS07720 (RA306_07715) | - | 1554394..1554930 (+) | 537 | WP_014391470.1 | phage N-6-adenine-methyltransferase | - |
| RA306_RS07725 (RA306_07720) | - | 1554920..1555378 (+) | 459 | WP_014391471.1 | recombination protein NinB | - |
| RA306_RS07730 (RA306_07725) | - | 1555452..1555664 (+) | 213 | WP_016533468.1 | hypothetical protein | - |
| RA306_RS07735 (RA306_07730) | - | 1555752..1556354 (+) | 603 | WP_016533469.1 | recombination protein NinG | - |
| RA306_RS07740 (RA306_07735) | - | 1556354..1556719 (+) | 366 | WP_016533470.1 | antiterminator Q family protein | - |
| RA306_RS07745 (RA306_07740) | - | 1557521..1557817 (+) | 297 | WP_014390733.1 | hypothetical protein | - |
| RA306_RS07750 (RA306_07745) | - | 1557814..1558344 (+) | 531 | WP_016533452.1 | lysozyme | - |
| RA306_RS07755 (RA306_07750) | - | 1558317..1558640 (+) | 324 | WP_075269227.1 | DUF2570 family protein | - |
| RA306_RS07760 (RA306_07755) | - | 1558865..1559281 (-) | 417 | WP_016533220.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| RA306_RS07765 (RA306_07760) | - | 1559329..1559505 (-) | 177 | WP_016533221.1 | type II toxin-antitoxin system HicA family toxin | - |
| RA306_RS07770 (RA306_07765) | - | 1559764..1560240 (+) | 477 | WP_016533222.1 | DUF1441 family protein | - |
| RA306_RS07775 (RA306_07770) | - | 1560243..1562351 (+) | 2109 | WP_016533223.1 | phage terminase large subunit family protein | - |
| RA306_RS07780 (RA306_07775) | - | 1562348..1562569 (+) | 222 | WP_014391481.1 | hypothetical protein | - |
| RA306_RS07785 (RA306_07780) | - | 1562566..1564104 (+) | 1539 | WP_016533224.1 | phage portal protein | - |
| RA306_RS07790 (RA306_07785) | - | 1564040..1566046 (+) | 2007 | WP_016533225.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| RA306_RS07795 (RA306_07790) | - | 1566120..1566446 (+) | 327 | WP_016533226.1 | DUF2190 family protein | - |
| RA306_RS07800 (RA306_07795) | - | 1566439..1566732 (+) | 294 | WP_014391484.1 | hypothetical protein | - |
| RA306_RS07805 (RA306_07800) | - | 1566732..1567283 (+) | 552 | WP_016533227.1 | phage tail protein | - |
| RA306_RS07810 (RA306_07805) | gpU | 1567280..1567687 (+) | 408 | WP_016533228.1 | phage tail terminator protein | - |
| RA306_RS07815 (RA306_07810) | - | 1567684..1568190 (+) | 507 | WP_016533229.1 | phage tail tube protein | - |
| RA306_RS07820 (RA306_07815) | - | 1568196..1568585 (+) | 390 | WP_016533230.1 | phage minor tail protein G | - |
| RA306_RS07825 (RA306_07820) | - | 1568606..1568908 (+) | 303 | WP_225529681.1 | phage tail assembly protein T | - |
| RA306_RS07830 (RA306_07825) | - | 1568895..1571048 (+) | 2154 | WP_075269215.1 | phage tail length tape measure family protein | - |
| RA306_RS07835 (RA306_07830) | - | 1571045..1571395 (+) | 351 | WP_005719622.1 | phage tail protein | - |
| RA306_RS07840 (RA306_07835) | - | 1571483..1572196 (+) | 714 | WP_023430122.1 | phage minor tail protein L | - |
| RA306_RS07845 (RA306_07840) | - | 1572199..1572939 (+) | 741 | WP_016570088.1 | C40 family peptidase | - |
| RA306_RS07850 (RA306_07845) | - | 1572882..1573472 (+) | 591 | WP_042743292.1 | tail assembly protein | - |
| RA306_RS07855 (RA306_07850) | - | 1573476..1581137 (+) | 7662 | WP_306610779.1 | phage tail protein | - |
Sequence
Protein
Download Length: 154 a.a. Molecular weight: 17207.00 Da Isoelectric Point: 6.9818
>NTDB_id=870494 RA306_RS07605 WP_016570065.1 1541810..1542274(-) (ssb) [Pasteurella multocida strain P1933]
MAGVNKVIIVGNLGNDPDVRTMPNGDAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQAQANAQANAQAPQNNAYANAKAGKPVQQADSFEDDSIPF
MAGVNKVIIVGNLGNDPDVRTMPNGDAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQAQANAQANAQAPQNNAYANAKAGKPVQQADSFEDDSIPF
Nucleotide
Download Length: 465 bp
>NTDB_id=870494 RA306_RS07605 WP_016570065.1 1541810..1542274(-) (ssb) [Pasteurella multocida strain P1933]
ATGGCTGGGGTAAATAAAGTAATTATCGTCGGGAATTTGGGAAACGATCCTGATGTCCGCACAATGCCAAATGGCGACGC
AGTGGCAAAAATTAGTGTGGCCACGAGCGAAAGTTGGATCGACAAAAACACGAACGAGCGAAAAACGCAGACAGAATGGC
ACTCTATCGTGTTTTATCGCCGCCAAGCAGAAATTTGCGGGCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACTGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCTAACGCACAAGCACCGCAAAACAATGCTTATGCCA
ATGCGAAAGCTGGAAAGCCAGTGCAACAGGCTGATAGTTTTGAAGATGATAGCATACCTTTTTAA
ATGGCTGGGGTAAATAAAGTAATTATCGTCGGGAATTTGGGAAACGATCCTGATGTCCGCACAATGCCAAATGGCGACGC
AGTGGCAAAAATTAGTGTGGCCACGAGCGAAAGTTGGATCGACAAAAACACGAACGAGCGAAAAACGCAGACAGAATGGC
ACTCTATCGTGTTTTATCGCCGCCAAGCAGAAATTTGCGGGCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACTGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCTAACGCACAAGCACCGCAAAACAATGCTTATGCCA
ATGCGAAAGCTGGAAAGCCAGTGCAACAGGCTGATAGTTTTGAAGATGATAGCATACCTTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
62.983 |
100 |
0.74 |
| ssb | Vibrio cholerae strain A1552 |
48.276 |
100 |
0.545 |
| ssb | Neisseria meningitidis MC58 |
42.775 |
100 |
0.481 |
| ssb | Neisseria gonorrhoeae MS11 |
42.775 |
100 |
0.481 |