Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LACPH_RS02435 | Genome accession | NZ_CP132482 |
| Coordinates | 520013..520450 (+) | Length | 145 a.a. |
| NCBI ID | WP_306387211.1 | Uniprot ID | - |
| Organism | Lacticaseibacillus parahuelsenbergensis strain NCIMB 15471 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 512044..555246 | 520013..520450 | within | 0 |
Gene organization within MGE regions
Location: 512044..555246
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LACPH_RS02370 (LACPH_000474) | - | 512044..513213 (-) | 1170 | WP_306387677.1 | site-specific integrase | - |
| LACPH_RS02375 (LACPH_000475) | - | 513540..514217 (-) | 678 | WP_204149148.1 | transcriptional regulator | - |
| LACPH_RS02380 (LACPH_000476) | - | 514277..514951 (-) | 675 | WP_306387203.1 | LexA family transcriptional regulator | - |
| LACPH_RS02385 (LACPH_000477) | - | 515113..515358 (+) | 246 | WP_306387204.1 | helix-turn-helix transcriptional regulator | - |
| LACPH_RS02390 (LACPH_000478) | - | 515355..515567 (+) | 213 | WP_306387205.1 | Bro-N domain-containing protein | - |
| LACPH_RS02395 (LACPH_000479) | - | 515669..516412 (+) | 744 | WP_306387206.1 | phage antirepressor KilAC domain-containing protein | - |
| LACPH_RS02400 (LACPH_000480) | - | 516666..517256 (-) | 591 | WP_005688510.1 | hypothetical protein | - |
| LACPH_RS02405 (LACPH_000481) | - | 517321..517677 (+) | 357 | WP_306387207.1 | DUF771 domain-containing protein | - |
| LACPH_RS02410 (LACPH_000482) | - | 517762..517914 (+) | 153 | WP_005712709.1 | hypothetical protein | - |
| LACPH_RS02415 (LACPH_000483) | - | 517919..518122 (+) | 204 | WP_306387208.1 | hypothetical protein | - |
| LACPH_RS02420 (LACPH_000484) | - | 518139..518630 (+) | 492 | WP_061713682.1 | siphovirus Gp157 family protein | - |
| LACPH_RS02425 (LACPH_000485) | - | 518642..519352 (+) | 711 | WP_306387209.1 | ERF family protein | - |
| LACPH_RS02430 (LACPH_000486) | - | 519330..519998 (+) | 669 | WP_306387210.1 | putative HNHc nuclease | - |
| LACPH_RS02435 (LACPH_000487) | ssb | 520013..520450 (+) | 438 | WP_306387211.1 | single-stranded DNA-binding protein | Machinery gene |
| LACPH_RS02440 (LACPH_000488) | - | 520467..521294 (+) | 828 | WP_306387678.1 | helix-turn-helix domain-containing protein | - |
| LACPH_RS02445 (LACPH_000489) | - | 521291..522553 (+) | 1263 | WP_306387212.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| LACPH_RS02450 (LACPH_000490) | - | 522555..522899 (+) | 345 | WP_284794981.1 | hypothetical protein | - |
| LACPH_RS02455 (LACPH_000491) | - | 522941..523342 (+) | 402 | WP_306387213.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LACPH_RS02460 (LACPH_000492) | - | 523352..524062 (+) | 711 | WP_306387214.1 | N-6 DNA methylase | - |
| LACPH_RS02465 (LACPH_000493) | - | 524108..524689 (+) | 582 | WP_306387215.1 | site-specific integrase | - |
| LACPH_RS02470 (LACPH_000494) | - | 524699..525277 (+) | 579 | WP_306387216.1 | hypothetical protein | - |
| LACPH_RS02475 (LACPH_000495) | - | 525301..525411 (+) | 111 | WP_306387217.1 | acetyltransferase | - |
| LACPH_RS02480 (LACPH_000496) | - | 525408..525929 (+) | 522 | WP_306387218.1 | DUF1642 domain-containing protein | - |
| LACPH_RS02485 (LACPH_000497) | - | 525922..526476 (+) | 555 | WP_306387219.1 | NUMOD4 domain-containing protein | - |
| LACPH_RS02490 (LACPH_000498) | - | 526469..526597 (+) | 129 | WP_306387220.1 | hypothetical protein | - |
| LACPH_RS02495 (LACPH_000499) | - | 526587..526970 (+) | 384 | WP_138117716.1 | DUF1642 domain-containing protein | - |
| LACPH_RS02500 (LACPH_000500) | - | 526967..527359 (+) | 393 | WP_306387221.1 | YopX family protein | - |
| LACPH_RS02505 (LACPH_000501) | - | 527356..527643 (+) | 288 | WP_138117718.1 | hypothetical protein | - |
| LACPH_RS02510 (LACPH_000502) | - | 527993..528436 (+) | 444 | WP_306387222.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LACPH_RS02515 (LACPH_000503) | - | 528748..529455 (+) | 708 | WP_204149130.1 | hypothetical protein | - |
| LACPH_RS02520 (LACPH_000504) | - | 529687..529905 (-) | 219 | WP_025013983.1 | CsbD family protein | - |
| LACPH_RS02525 (LACPH_000505) | - | 530312..531460 (+) | 1149 | WP_306387223.1 | GcrA family cell cycle regulator | - |
| LACPH_RS02530 (LACPH_000506) | - | 531453..531776 (+) | 324 | WP_306387224.1 | ribonucleoside-diphosphate reductase | - |
| LACPH_RS02535 (LACPH_000507) | - | 531779..532096 (+) | 318 | WP_306387225.1 | hypothetical protein | - |
| LACPH_RS02540 (LACPH_000508) | - | 532247..533047 (+) | 801 | WP_306387226.1 | HNH endonuclease | - |
| LACPH_RS02545 (LACPH_000509) | - | 533251..533706 (+) | 456 | WP_306387227.1 | P27 family phage terminase small subunit | - |
| LACPH_RS02550 (LACPH_000510) | - | 533728..535440 (+) | 1713 | WP_306387228.1 | terminase large subunit | - |
| LACPH_RS02555 (LACPH_000511) | - | 535452..535643 (+) | 192 | WP_003661399.1 | hypothetical protein | - |
| LACPH_RS02560 (LACPH_000512) | - | 535649..536902 (+) | 1254 | WP_306387229.1 | phage portal protein | - |
| LACPH_RS02565 (LACPH_000513) | - | 536856..537485 (+) | 630 | WP_306387230.1 | HK97 family phage prohead protease | - |
| LACPH_RS02570 (LACPH_000514) | - | 537527..538729 (+) | 1203 | WP_306387231.1 | phage major capsid protein | - |
| LACPH_RS02575 (LACPH_000515) | - | 538747..538986 (+) | 240 | WP_306387232.1 | Ig-like domain-containing protein | - |
| LACPH_RS02580 (LACPH_000516) | - | 538997..539356 (+) | 360 | WP_306387233.1 | head-tail connector protein | - |
| LACPH_RS02585 (LACPH_000517) | - | 539346..539675 (+) | 330 | WP_306387234.1 | head-tail adaptor protein | - |
| LACPH_RS02590 (LACPH_000518) | - | 539675..540061 (+) | 387 | WP_306387235.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LACPH_RS02595 (LACPH_000519) | - | 540061..540447 (+) | 387 | WP_306387236.1 | phage tail protein | - |
| LACPH_RS02600 (LACPH_000520) | - | 540481..541089 (+) | 609 | WP_087911794.1 | major tail protein | - |
| LACPH_RS02605 (LACPH_000521) | - | 541143..541331 (+) | 189 | WP_236944229.1 | Ig-like domain-containing protein | - |
| LACPH_RS02610 (LACPH_000522) | gpG | 541402..541815 (+) | 414 | WP_003661382.1 | phage tail assembly chaperone G | - |
| LACPH_RS02615 (LACPH_000523) | - | 541938..546800 (+) | 4863 | WP_306387237.1 | phage tail tape measure protein | - |
| LACPH_RS02620 (LACPH_000524) | - | 546801..548861 (+) | 2061 | WP_306387238.1 | distal tail protein Dit | - |
| LACPH_RS02625 (LACPH_000525) | - | 548862..551297 (+) | 2436 | WP_306387239.1 | phage tail protein | - |
| LACPH_RS02630 (LACPH_000526) | - | 551299..551589 (+) | 291 | WP_306387240.1 | hypothetical protein | - |
| LACPH_RS02635 (LACPH_000527) | - | 551582..551713 (+) | 132 | WP_019888587.1 | XkdX family protein | - |
| LACPH_RS02640 (LACPH_000528) | - | 551743..552033 (+) | 291 | WP_306387241.1 | hypothetical protein | - |
| LACPH_RS02645 (LACPH_000529) | - | 552026..552361 (+) | 336 | Protein_527 | phage holin | - |
| LACPH_RS02650 (LACPH_000530) | - | 552649..552921 (+) | 273 | WP_070543981.1 | DUF6275 family protein | - |
| LACPH_RS02655 (LACPH_000531) | - | 552933..554096 (+) | 1164 | WP_306387242.1 | GH25 family lysozyme | - |
| LACPH_RS02660 (LACPH_000532) | - | 554461..555246 (+) | 786 | WP_274784406.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 15916.45 Da Isoelectric Point: 4.8434
>NTDB_id=869181 LACPH_RS02435 WP_306387211.1 520013..520450(+) (ssb) [Lacticaseibacillus parahuelsenbergensis strain NCIMB 15471]
MLNSVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGNRDTDFINCAIWRKSAENFANFTHKGSLVGIEGHIQTR
TYDNAQGQKVFVTEVIVENFALLEPRQMSQDSQQRSDNNPAAASQGNGFANNGQPVDVSDDDLPF
MLNSVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGNRDTDFINCAIWRKSAENFANFTHKGSLVGIEGHIQTR
TYDNAQGQKVFVTEVIVENFALLEPRQMSQDSQQRSDNNPAAASQGNGFANNGQPVDVSDDDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=869181 LACPH_RS02435 WP_306387211.1 520013..520450(+) (ssb) [Lacticaseibacillus parahuelsenbergensis strain NCIMB 15471]
ATGCTTAATTCAGTTGCTTTAACAGGCAGATTAACTAAAGACGTTGACCTTCGCTACACACAAAGCGGAACGGCAGTCGG
TTCATTCACAATCGCTGTTGACCGTCAATTCCGCAGTGCGAACGGTAACCGGGATACTGACTTCATCAATTGTGCCATCT
GGCGTAAGTCTGCTGAGAATTTTGCCAACTTTACGCACAAGGGTTCACTCGTTGGCATCGAAGGTCATATCCAAACACGT
ACGTACGATAACGCGCAAGGCCAGAAAGTATTCGTGACTGAGGTCATTGTTGAGAATTTTGCTTTGCTTGAGCCACGGCA
GATGTCTCAGGACAGCCAACAGCGATCGGATAATAACCCAGCGGCCGCAAGCCAAGGCAACGGTTTTGCTAACAATGGCC
AGCCAGTCGATGTCAGCGATGATGATCTTCCATTCTAA
ATGCTTAATTCAGTTGCTTTAACAGGCAGATTAACTAAAGACGTTGACCTTCGCTACACACAAAGCGGAACGGCAGTCGG
TTCATTCACAATCGCTGTTGACCGTCAATTCCGCAGTGCGAACGGTAACCGGGATACTGACTTCATCAATTGTGCCATCT
GGCGTAAGTCTGCTGAGAATTTTGCCAACTTTACGCACAAGGGTTCACTCGTTGGCATCGAAGGTCATATCCAAACACGT
ACGTACGATAACGCGCAAGGCCAGAAAGTATTCGTGACTGAGGTCATTGTTGAGAATTTTGCTTTGCTTGAGCCACGGCA
GATGTCTCAGGACAGCCAACAGCGATCGGATAATAACCCAGCGGCCGCAAGCCAAGGCAACGGTTTTGCTAACAATGGCC
AGCCAGTCGATGTCAGCGATGATGATCTTCCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.662 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.093 |
100 |
0.559 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.887 |
73.103 |
0.379 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
37.241 |
100 |
0.372 |