Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   Q9Q93_RS02030 Genome accession   NZ_CP132232
Coordinates   427014..427550 (+) Length   178 a.a.
NCBI ID   WP_306166193.1    Uniprot ID   -
Organism   Enterobacter hormaechei strain RSY19     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 414944..484132 427014..427550 within 0


Gene organization within MGE regions


Location: 414944..484132
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q9Q93_RS01965 (Q9Q93_01965) - 415055..415927 (+) 873 WP_306166175.1 ParA family protein -
  Q9Q93_RS01970 (Q9Q93_01970) - 415924..416307 (+) 384 WP_306166177.1 hypothetical protein -
  Q9Q93_RS01975 (Q9Q93_01975) dnaB-PI 416300..417670 (+) 1371 WP_306166179.1 SPI-7-type island replicative DNA helicase -
  Q9Q93_RS01980 (Q9Q93_01980) - 417667..419367 (+) 1701 WP_306166181.1 ParB family protein -
  Q9Q93_RS01985 (Q9Q93_01985) - 419360..420070 (+) 711 WP_306166183.1 DUF2786 domain-containing protein -
  Q9Q93_RS01990 (Q9Q93_01990) - 420077..420667 (+) 591 WP_006777722.1 DUF2857 domain-containing protein -
  Q9Q93_RS01995 (Q9Q93_01995) - 420664..420912 (+) 249 WP_306166185.1 hypothetical protein -
  Q9Q93_RS02000 (Q9Q93_02000) - 421012..422250 (+) 1239 WP_306166187.1 STY4528 family pathogenicity island replication protein -
  Q9Q93_RS02005 (Q9Q93_02005) - 422263..422472 (-) 210 WP_306166189.1 hypothetical protein -
  Q9Q93_RS02010 (Q9Q93_02010) - 422541..423266 (+) 726 WP_004115569.1 PFL_4669 family integrating conjugative element protein -
  Q9Q93_RS02015 (Q9Q93_02015) - 423268..423822 (+) 555 WP_029593104.1 hypothetical protein -
  Q9Q93_RS02020 (Q9Q93_02020) - 423838..425847 (+) 2010 WP_306166191.1 DNA topoisomerase III -
  Q9Q93_RS02025 (Q9Q93_02025) - 426483..426953 (+) 471 WP_029593102.1 STY4534 family ICE replication protein -
  Q9Q93_RS02030 (Q9Q93_02030) ssb 427014..427550 (+) 537 WP_306166193.1 single-stranded DNA-binding protein Machinery gene
  Q9Q93_RS02035 (Q9Q93_02035) - 427615..427857 (+) 243 WP_004115560.1 DUF4160 domain-containing protein -
  Q9Q93_RS02040 (Q9Q93_02040) - 427841..428089 (+) 249 WP_004115558.1 DUF2442 domain-containing protein -
  Q9Q93_RS02045 (Q9Q93_02045) - 428226..428891 (+) 666 WP_306166195.1 PilL N-terminal domain-containing protein -
  Q9Q93_RS02050 (Q9Q93_02050) - 428888..429646 (+) 759 WP_370350094.1 hypothetical protein -
  Q9Q93_RS02055 (Q9Q93_02055) - 429658..430380 (+) 723 WP_088244032.1 TIGR03759 family integrating conjugative element protein -
  Q9Q93_RS02060 (Q9Q93_02060) - 430359..430994 (+) 636 WP_031624646.1 transglycosylase SLT domain-containing protein -
  Q9Q93_RS02065 (Q9Q93_02065) - 431000..431521 (+) 522 WP_306166197.1 integrating conjugative element protein -
  Q9Q93_RS02070 (Q9Q93_02070) - 431521..432093 (+) 573 WP_306166199.1 restriction endonuclease -
  Q9Q93_RS02075 (Q9Q93_02075) - 432104..432592 (+) 489 WP_306166201.1 hypothetical protein -
  Q9Q93_RS02080 (Q9Q93_02080) traD 432585..434684 (+) 2100 WP_306166203.1 type IV conjugative transfer system coupling protein TraD -
  Q9Q93_RS02085 (Q9Q93_02085) - 434677..435435 (+) 759 WP_006785966.1 TIGR03747 family integrating conjugative element membrane protein -
  Q9Q93_RS02090 (Q9Q93_02090) - 435526..435873 (-) 348 WP_016808262.1 FxLYD domain-containing protein -
  Q9Q93_RS02095 (Q9Q93_02095) - 436058..436405 (+) 348 WP_137467528.1 RAQPRD family integrative conjugative element protein -
  Q9Q93_RS02100 (Q9Q93_02100) - 436405..436647 (+) 243 WP_004115536.1 TIGR03758 family integrating conjugative element protein -
  Q9Q93_RS02105 (Q9Q93_02105) - 436683..437069 (+) 387 WP_006785968.1 TIGR03745 family integrating conjugative element membrane protein -
  Q9Q93_RS02110 (Q9Q93_02110) - 437082..437438 (+) 357 WP_004115534.1 TIGR03750 family conjugal transfer protein -
  Q9Q93_RS02115 (Q9Q93_02115) - 437435..438094 (+) 660 WP_004115533.1 PFL_4703 family integrating conjugative element protein -
  Q9Q93_RS02120 (Q9Q93_02120) - 438094..439044 (+) 951 WP_306166206.1 TIGR03749 family integrating conjugative element protein -
  Q9Q93_RS02125 (Q9Q93_02125) - 439034..440533 (+) 1500 WP_306166208.1 TIGR03752 family integrating conjugative element protein -
  Q9Q93_RS02130 (Q9Q93_02130) - 440544..440912 (+) 369 WP_016151320.1 hypothetical protein -
  Q9Q93_RS02135 (Q9Q93_02135) - 440912..441322 (+) 411 WP_006785978.1 TIGR03751 family conjugal transfer lipoprotein -
  Q9Q93_RS02140 (Q9Q93_02140) - 441322..444180 (+) 2859 WP_306166211.1 conjugative transfer ATPase -
  Q9Q93_RS02145 (Q9Q93_02145) - 444177..444554 (+) 378 WP_119640205.1 acetyltransferase -
  Q9Q93_RS02150 (Q9Q93_02150) - 444722..446515 (+) 1794 WP_306166214.1 DUF262 domain-containing protein -
  Q9Q93_RS02155 (Q9Q93_02155) - 446828..447226 (+) 399 WP_306166217.1 TIGR03757 family integrating conjugative element protein -
  Q9Q93_RS02160 (Q9Q93_02160) - 447223..448215 (+) 993 WP_306166218.1 TIGR03756 family integrating conjugative element protein -
  Q9Q93_RS02165 (Q9Q93_02165) - 448215..449690 (+) 1476 WP_306166220.1 integrating conjugative element protein -
  Q9Q93_RS02170 (Q9Q93_02170) - 449701..450039 (+) 339 WP_306166222.1 hypothetical protein -
  Q9Q93_RS02175 (Q9Q93_02175) - 450042..451565 (+) 1524 WP_306166224.1 conjugal transfer protein TraG N-terminal domain-containing protein -
  Q9Q93_RS02180 (Q9Q93_02180) - 451590..451991 (-) 402 WP_306166226.1 hypothetical protein -
  Q9Q93_RS02185 (Q9Q93_02185) umuD 452272..452709 (+) 438 WP_306166855.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
  Q9Q93_RS02190 (Q9Q93_02190) umuC 452712..453983 (+) 1272 WP_306166228.1 translesion error-prone DNA polymerase V subunit UmuC -
  Q9Q93_RS02195 (Q9Q93_02195) - 454129..454677 (+) 549 WP_256767805.1 hypothetical protein -
  Q9Q93_RS02200 (Q9Q93_02200) - 454740..455411 (-) 672 WP_306166230.1 CPBP family intramembrane glutamic endopeptidase -
  Q9Q93_RS02205 (Q9Q93_02205) - 456384..457283 (+) 900 WP_306166232.1 integrase domain-containing protein -
  Q9Q93_RS02210 (Q9Q93_02210) - 457293..457502 (-) 210 WP_306166234.1 LysR family transcriptional regulator -
  Q9Q93_RS02215 (Q9Q93_02215) - 457770..458663 (-) 894 WP_306166236.1 LysR family transcriptional regulator -
  Q9Q93_RS02220 (Q9Q93_02220) - 458766..459095 (+) 330 WP_036114537.1 YciI family protein -
  Q9Q93_RS02225 (Q9Q93_02225) - 459247..459804 (-) 558 WP_080861672.1 flavin reductase family protein -
  Q9Q93_RS02230 (Q9Q93_02230) - 459863..460720 (-) 858 WP_306166240.1 SDR family oxidoreductase -
  Q9Q93_RS02235 (Q9Q93_02235) - 460756..461523 (-) 768 WP_306166241.1 SDR family NAD(P)-dependent oxidoreductase -
  Q9Q93_RS02240 (Q9Q93_02240) - 461558..462301 (-) 744 WP_306166243.1 SDR family oxidoreductase -
  Q9Q93_RS02245 (Q9Q93_02245) - 462499..463443 (+) 945 WP_022065304.1 AraC family transcriptional regulator -
  Q9Q93_RS02250 (Q9Q93_02250) - 463772..464146 (-) 375 WP_036114529.1 hypothetical protein -
  Q9Q93_RS02255 (Q9Q93_02255) - 464258..464677 (+) 420 WP_075324497.1 Rrf2 family transcriptional regulator -
  Q9Q93_RS02260 (Q9Q93_02260) - 464732..467923 (-) 3192 WP_306166246.1 efflux RND transporter permease subunit -
  Q9Q93_RS02265 (Q9Q93_02265) - 467920..469089 (-) 1170 WP_306166248.1 efflux RND transporter periplasmic adaptor subunit -
  Q9Q93_RS02270 (Q9Q93_02270) - 469829..470197 (+) 369 WP_181958952.1 hypothetical protein -
  Q9Q93_RS02275 (Q9Q93_02275) - 470663..471028 (+) 366 WP_006781400.1 hypothetical protein -
  Q9Q93_RS02280 (Q9Q93_02280) - 471114..471761 (+) 648 WP_306166251.1 hypothetical protein -
  Q9Q93_RS02285 (Q9Q93_02285) - 471830..472303 (+) 474 WP_306166253.1 DUF3085 domain-containing protein -
  Q9Q93_RS02290 (Q9Q93_02290) - 472499..472846 (+) 348 WP_200779329.1 hypothetical protein -
  Q9Q93_RS02295 (Q9Q93_02295) - 472928..473914 (+) 987 WP_200779328.1 ArdC family protein -
  Q9Q93_RS02300 (Q9Q93_02300) - 474020..474952 (+) 933 WP_306166256.1 DUF1281 domain-containing protein -
  Q9Q93_RS02305 (Q9Q93_02305) - 475061..475384 (+) 324 Protein_444 SAM-dependent DNA methyltransferase -
  Q9Q93_RS02310 (Q9Q93_02310) - 475504..476370 (-) 867 WP_306166258.1 ImmA/IrrE family metallo-endopeptidase -
  Q9Q93_RS02315 (Q9Q93_02315) - 476373..476696 (-) 324 WP_001515173.1 helix-turn-helix domain-containing protein -
  Q9Q93_RS02320 (Q9Q93_02320) - 476879..477844 (+) 966 WP_306166262.1 CBASS oligonucleotide cyclase -
  Q9Q93_RS02325 (Q9Q93_02325) cap7 477852..478370 (+) 519 WP_306166265.1 CBASS phage resistance system CD-NTase-associated protein Cap7 -
  Q9Q93_RS02330 (Q9Q93_02330) cap6 478367..479299 (+) 933 WP_306166267.1 CBASS phage resistance system CD-NTase-associated protein Cap6 -
  Q9Q93_RS02335 (Q9Q93_02335) nucC 479390..480115 (+) 726 WP_075201405.1 CBASS effector endonuclease NucC -
  Q9Q93_RS02340 (Q9Q93_02340) - 480108..480395 (-) 288 WP_306166269.1 hypothetical protein -
  Q9Q93_RS02345 (Q9Q93_02345) - 480472..481110 (+) 639 Protein_452 ATP-binding domain-containing protein -
  Q9Q93_RS02350 (Q9Q93_02350) - 481177..482796 (+) 1620 WP_306166272.1 TraI domain-containing protein -
  Q9Q93_RS02355 (Q9Q93_02355) - 482857..483888 (+) 1032 WP_306166274.1 site-specific integrase -

Sequence


Protein


Download         Length: 178 a.a.        Molecular weight: 19150.27 Da        Isoelectric Point: 6.7295

>NTDB_id=867933 Q9Q93_RS02030 WP_306166193.1 427014..427550(+) (ssb) [Enterobacter hormaechei strain RSY19]
MSSRGVNKVILVGNLGQDPEVRYIPNGSAVATLSLATSESWRDKQSGEQKEVTEWHRVVIFGKLAEIAGEYLRKGSQVYI
EGQLRTRKWTDQAGQDKYTTEVVVNIGGTMQMLGGRQPGSGQNTSSRNDWGQPQQPSGPTHSGQASGSSAGAPPMDFDDD
IPFIGFGYGVPKSAIHAL

Nucleotide


Download         Length: 537 bp        

>NTDB_id=867933 Q9Q93_RS02030 WP_306166193.1 427014..427550(+) (ssb) [Enterobacter hormaechei strain RSY19]
ATGTCCTCACGCGGCGTTAACAAGGTTATTCTTGTCGGAAACCTCGGCCAGGATCCTGAAGTTCGTTATATTCCTAACGG
CAGCGCAGTTGCCACCCTTTCGCTGGCCACGTCTGAGAGCTGGCGCGATAAGCAGTCAGGTGAACAGAAAGAAGTGACCG
AATGGCATCGAGTGGTTATTTTCGGCAAGCTGGCAGAAATTGCGGGTGAATATCTGCGTAAAGGCTCCCAGGTTTACATC
GAGGGCCAGCTGCGCACACGCAAATGGACCGATCAGGCCGGCCAGGATAAATACACCACAGAGGTGGTGGTCAATATTGG
TGGCACCATGCAGATGCTTGGCGGTCGGCAGCCCGGCAGCGGTCAGAATACGTCTTCCCGGAATGACTGGGGCCAGCCTC
AGCAACCTTCCGGACCGACTCACAGTGGCCAGGCTTCCGGCAGCAGTGCCGGTGCACCACCGATGGACTTCGATGACGAT
ATACCGTTCATTGGATTCGGGTATGGAGTACCAAAATCGGCAATCCATGCACTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

63.277

99.438

0.629

  ssb Glaesserella parasuis strain SC1401

49.724

100

0.506

  ssb Neisseria meningitidis MC58

44.068

99.438

0.438

  ssb Neisseria gonorrhoeae MS11

43.75

98.876

0.433