Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   Q7568_RS13695 Genome accession   NZ_CP131896
Coordinates   2864260..2864361 (-) Length   33 a.a.
NCBI ID   WP_168713084.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain 2010N16-194     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2862784..2905653 2864260..2864361 within 0


Gene organization within MGE regions


Location: 2862784..2905653
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q7568_RS13690 (Q7568_13735) - 2862784..2863830 (-) 1047 WP_000027064.1 nucleoid-associated protein -
  Q7568_RS13695 (Q7568_13740) ssb 2864260..2864361 (-) 102 WP_168713084.1 single-stranded DNA-binding protein Machinery gene
  Q7568_RS13700 (Q7568_13745) - 2864343..2865785 (-) 1443 WP_000003535.1 hypothetical protein -
  Q7568_RS13705 (Q7568_13750) - 2866008..2866124 (-) 117 WP_001992235.1 single-stranded DNA-binding protein -
  Q7568_RS13710 (Q7568_13755) - 2866458..2868923 (-) 2466 WP_001022397.1 DUF927 domain-containing protein -
  Q7568_RS13715 (Q7568_13760) - 2868936..2869214 (-) 279 WP_001064707.1 hypothetical protein -
  Q7568_RS13720 (Q7568_13765) - 2869336..2869641 (-) 306 WP_000787149.1 hypothetical protein -
  Q7568_RS13725 (Q7568_13770) - 2869651..2870019 (-) 369 WP_001046481.1 hypothetical protein -
  Q7568_RS13730 (Q7568_13775) - 2870012..2870566 (-) 555 WP_001988245.1 BRO family protein -
  Q7568_RS13735 (Q7568_13780) - 2870563..2870772 (-) 210 WP_001016479.1 helix-turn-helix domain-containing protein -
  Q7568_RS13740 (Q7568_13785) - 2870775..2870990 (-) 216 WP_000153154.1 hypothetical protein -
  Q7568_RS13745 (Q7568_13790) - 2871200..2871967 (-) 768 WP_000578618.1 hypothetical protein -
  Q7568_RS13750 (Q7568_13795) - 2872115..2873344 (-) 1230 WP_001991065.1 tyrosine-type recombinase/integrase -
  Q7568_RS13755 (Q7568_13800) - 2873720..2874385 (-) 666 WP_001050367.1 hypothetical protein -
  Q7568_RS13760 (Q7568_13805) - 2874534..2875169 (+) 636 WP_000332614.1 SOS response-associated peptidase family protein -
  Q7568_RS13765 (Q7568_13810) umuD 2875311..2875811 (+) 501 WP_000022554.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
  Q7568_RS13770 (Q7568_13815) - 2875808..2877106 (+) 1299 WP_001215499.1 DNA polymerase V subunit UmuC -
  Q7568_RS13775 (Q7568_13820) - 2877260..2877958 (+) 699 WP_001072150.1 hypothetical protein -
  Q7568_RS13780 (Q7568_13825) - 2878081..2878284 (-) 204 Protein_2699 IS5/IS1182 family transposase -
  Q7568_RS13785 (Q7568_13830) - 2878285..2878701 (+) 417 Protein_2700 hypothetical protein -
  Q7568_RS13790 (Q7568_13835) - 2878827..2879597 (-) 771 WP_000766533.1 TIGR02594 family protein -
  Q7568_RS13795 (Q7568_13840) - 2879594..2879881 (-) 288 WP_001279704.1 holin -
  Q7568_RS13800 (Q7568_13845) - 2880003..2880221 (-) 219 WP_000894311.1 hypothetical protein -
  Q7568_RS13805 (Q7568_13850) - 2880214..2880912 (-) 699 WP_000627455.1 hypothetical protein -
  Q7568_RS13810 (Q7568_13855) - 2880912..2881706 (-) 795 WP_000030337.1 hypothetical protein -
  Q7568_RS13815 (Q7568_13860) - 2881794..2882042 (-) 249 WP_000594623.1 transcriptional regulator -
  Q7568_RS13820 (Q7568_13865) - 2882244..2883143 (+) 900 WP_000067916.1 phage antirepressor N-terminal domain-containing protein -
  Q7568_RS13825 (Q7568_13870) - 2883302..2884015 (-) 714 WP_000373973.1 hypothetical protein -
  Q7568_RS13830 (Q7568_13875) - 2884231..2885310 (-) 1080 WP_000067934.1 XRE family transcriptional regulator -
  Q7568_RS13835 (Q7568_13880) - 2885307..2885936 (-) 630 WP_000951724.1 hypothetical protein -
  Q7568_RS13840 (Q7568_13885) - 2886087..2887538 (-) 1452 WP_000209673.1 hypothetical protein -
  Q7568_RS13845 (Q7568_13890) - 2887538..2889490 (-) 1953 WP_002093906.1 hypothetical protein -
  Q7568_RS13850 (Q7568_13895) - 2889564..2890217 (-) 654 WP_000863706.1 hypothetical protein -
  Q7568_RS13855 (Q7568_13900) - 2890217..2891752 (-) 1536 WP_000098517.1 hypothetical protein -
  Q7568_RS13860 (Q7568_13905) - 2891911..2892105 (+) 195 WP_000852568.1 hypothetical protein -
  Q7568_RS13865 (Q7568_13910) - 2892133..2892903 (-) 771 WP_000852828.1 hypothetical protein -
  Q7568_RS13870 (Q7568_13915) - 2892903..2893190 (-) 288 WP_002017462.1 hypothetical protein -
  Q7568_RS13875 (Q7568_13920) - 2893302..2903657 (-) 10356 WP_342252756.1 interleukin-like EMT inducer domain-containing protein -
  Q7568_RS13880 (Q7568_13925) - 2903667..2904560 (-) 894 WP_001167468.1 hypothetical protein -
  Q7568_RS13885 (Q7568_13930) - 2904560..2905009 (-) 450 WP_001240941.1 hypothetical protein -
  Q7568_RS13890 (Q7568_13935) - 2905009..2905653 (-) 645 WP_001187723.1 hypothetical protein -

Sequence

Protein


Download         Length: 33 a.a.        Molecular weight: 3621.22 Da        Isoelectric Point: 9.7265

>NTDB_id=865906 Q7568_RS13695 WP_168713084.1 2864260..2864361(-) (ssb) [Acinetobacter baumannii strain 2010N16-194]
MVSSQLAEISSKYLKKGGKVYVEGSLCTGKWKD

Nucleotide


Download         Length: 102 bp        

>NTDB_id=865906 Q7568_RS13695 WP_168713084.1 2864260..2864361(-) (ssb) [Acinetobacter baumannii strain 2010N16-194]
TTGGTTAGTTCCCAATTAGCCGAGATTTCCAGTAAGTACCTTAAGAAAGGTGGCAAGGTTTATGTTGAGGGTTCATTGTG
TACTGGGAAGTGGAAAGACTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-33)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

62.963

81.818

0.515
  ssb Vibrio cholerae strain A1552

55.172

87.879

0.485
  ssb Neisseria gonorrhoeae MS11

53.571

84.848

0.455
  ssb Neisseria meningitidis MC58

53.571

84.848

0.455