Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   K5638_RS11495 Genome accession   NZ_AP024614
Coordinates   2578072..2578602 (-) Length   176 a.a.
NCBI ID   WP_221059840.1    Uniprot ID   -
Organism   Shewanella algae strain TUM17382     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2546175..2597304 2578072..2578602 within 0


Gene organization within MGE regions


Location: 2546175..2597304
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K5638_RS11300 (TUM17382_22330) - 2546175..2547044 (-) 870 WP_221059809.1 CLCA_X family protein -
  K5638_RS11305 (TUM17382_22340) - 2547449..2547724 (-) 276 WP_221059810.1 hypothetical protein -
  K5638_RS11310 (TUM17382_22350) - 2547734..2549125 (-) 1392 WP_221059811.1 SUMF1/EgtB/PvdO family nonheme iron enzyme -
  K5638_RS11315 (TUM17382_22360) - 2549174..2549878 (-) 705 WP_221059812.1 hypothetical protein -
  K5638_RS11320 (TUM17382_22380) - 2550222..2553941 (-) 3720 WP_221059813.1 phage tail protein -
  K5638_RS11325 (TUM17382_22390) - 2553995..2554537 (-) 543 WP_144380119.1 Rha family transcriptional regulator -
  K5638_RS11330 (TUM17382_22400) - 2555159..2555692 (+) 534 WP_221059814.1 hypothetical protein -
  K5638_RS11335 (TUM17382_22410) - 2555715..2556146 (+) 432 WP_221059815.1 type II toxin-antitoxin system YafO family toxin -
  K5638_RS11340 (TUM17382_22420) - 2556157..2556381 (+) 225 WP_221059816.1 Arc family DNA-binding protein -
  K5638_RS11345 (TUM17382_22430) - 2556371..2556832 (+) 462 WP_221059817.1 hypothetical protein -
  K5638_RS11350 (TUM17382_22440) - 2556832..2557173 (+) 342 WP_221059818.1 hypothetical protein -
  K5638_RS11355 (TUM17382_22450) - 2557190..2560246 (-) 3057 WP_221059819.1 phage tail tape measure protein -
  K5638_RS11360 (TUM17382_22460) - 2560320..2560478 (-) 159 WP_186298915.1 hypothetical protein -
  K5638_RS11365 (TUM17382_22470) - 2560575..2561153 (-) 579 WP_221059820.1 tail assembly protein -
  K5638_RS11370 (TUM17382_22480) - 2561167..2561946 (-) 780 WP_221059821.1 C40 family peptidase -
  K5638_RS11375 (TUM17382_22490) - 2561951..2562649 (-) 699 WP_208163808.1 phage minor tail protein L -
  K5638_RS11380 (TUM17382_22500) - 2562646..2562999 (-) 354 WP_221059822.1 phage tail protein -
  K5638_RS11385 (TUM17382_22520) - 2563307..2563723 (-) 417 WP_144380125.1 hypothetical protein -
  K5638_RS11390 (TUM17382_22530) - 2563767..2564918 (-) 1152 WP_221059823.1 phage tail tube protein -
  K5638_RS11395 (TUM17382_22540) - 2565009..2565428 (-) 420 WP_221059824.1 phage tail terminator-like protein -
  K5638_RS11400 (TUM17382_22550) - 2565425..2565823 (-) 399 WP_221059825.1 hypothetical protein -
  K5638_RS11405 (TUM17382_22560) - 2565816..2566208 (-) 393 WP_221059826.1 hypothetical protein -
  K5638_RS11410 (TUM17382_22570) - 2566205..2566576 (-) 372 WP_221059827.1 glutamate 5-kinase -
  K5638_RS11415 (TUM17382_22580) - 2566579..2567187 (-) 609 WP_221059828.1 hypothetical protein -
  K5638_RS11420 (TUM17382_22590) - 2567189..2567602 (-) 414 WP_208163817.1 hypothetical protein -
  K5638_RS11425 (TUM17382_22600) - 2567605..2567841 (-) 237 WP_144380134.1 hypothetical protein -
  K5638_RS11430 (TUM17382_22610) - 2567900..2569054 (-) 1155 WP_221059829.1 P22 phage major capsid protein family protein -
  K5638_RS11435 (TUM17382_22620) - 2569154..2569921 (-) 768 WP_208163820.1 DUF6651 domain-containing protein -
  K5638_RS11440 (TUM17382_22630) - 2570028..2571221 (-) 1194 WP_221059830.1 minor capsid protein -
  K5638_RS11445 (TUM17382_22640) - 2571208..2572755 (-) 1548 WP_221059831.1 DUF4055 domain-containing protein -
  K5638_RS11450 (TUM17382_22650) - 2572762..2574048 (-) 1287 WP_259663276.1 terminase large subunit -
  K5638_RS11455 (TUM17382_22660) - 2574023..2574496 (-) 474 WP_221059833.1 DUF2280 domain-containing protein -
  K5638_RS11460 (TUM17382_22670) - 2574526..2575143 (-) 618 WP_221059834.1 putative metallopeptidase -
  K5638_RS11465 (TUM17382_22680) - 2575149..2575496 (-) 348 WP_311043264.1 HP1 family phage holin -
  K5638_RS22820 lysC 2575444..2575770 (-) 327 WP_375336911.1 Rz1-like lysis system protein LysC -
  K5638_RS11475 (TUM17382_22700) - 2576070..2576582 (-) 513 WP_221059836.1 glycoside hydrolase family protein -
  K5638_RS11480 (TUM17382_22710) - 2576585..2576848 (-) 264 WP_221059837.1 hypothetical protein -
  K5638_RS11485 (TUM17382_22720) - 2577099..2577308 (-) 210 WP_221059838.1 hypothetical protein -
  K5638_RS11490 (TUM17382_22740) - 2577478..2578059 (-) 582 WP_221059839.1 hypothetical protein -
  K5638_RS11495 (TUM17382_22750) ssb 2578072..2578602 (-) 531 WP_221059840.1 single-stranded DNA-binding protein Machinery gene
  K5638_RS11500 - 2578617..2578919 (-) 303 WP_208140422.1 nuclease domain-containing protein -
  K5638_RS11505 (TUM17382_22770) - 2578916..2579389 (-) 474 WP_221059841.1 DUF1367 family protein -
  K5638_RS11510 (TUM17382_22780) - 2579371..2579841 (-) 471 WP_221059842.1 hypothetical protein -
  K5638_RS11515 (TUM17382_22790) - 2579838..2580218 (-) 381 WP_221059843.1 hypothetical protein -
  K5638_RS11520 (TUM17382_22800) - 2580208..2580936 (-) 729 WP_221059844.1 replication protein P -
  K5638_RS11525 (TUM17382_22810) - 2580933..2581772 (-) 840 WP_221059845.1 helix-turn-helix domain-containing protein -
  K5638_RS11530 (TUM17382_22820) - 2581774..2582256 (-) 483 WP_221059846.1 phage regulatory CII family protein -
  K5638_RS22825 (TUM17382_22830) - 2582275..2582523 (-) 249 WP_144380154.1 helix-turn-helix transcriptional regulator -
  K5638_RS11540 (TUM17382_22840) - 2582643..2583302 (+) 660 WP_259663278.1 LexA family transcriptional regulator -
  K5638_RS11545 (TUM17382_22850) - 2583337..2584284 (+) 948 WP_221059848.1 hypothetical protein -
  K5638_RS11550 (TUM17382_22860) - 2584277..2584621 (+) 345 WP_221059849.1 DUF4325 domain-containing protein -
  K5638_RS11555 (TUM17382_22870) - 2584618..2585079 (+) 462 WP_221059850.1 hypothetical protein -
  K5638_RS11560 (TUM17382_22880) - 2585957..2586340 (+) 384 WP_208140451.1 hypothetical protein -
  K5638_RS11565 (TUM17382_22890) - 2586334..2586657 (+) 324 WP_221059851.1 hypothetical protein -
  K5638_RS11570 (TUM17382_22900) - 2586660..2587865 (+) 1206 WP_221059852.1 PD-(D/E)XK nuclease-like domain-containing protein -
  K5638_RS11575 (TUM17382_22910) - 2587862..2588239 (+) 378 WP_208140454.1 hypothetical protein -
  K5638_RS11580 (TUM17382_22920) - 2588236..2589171 (+) 936 WP_221059853.1 RecT family recombinase -
  K5638_RS11585 (TUM17382_22930) - 2589289..2590344 (+) 1056 WP_221059854.1 hypothetical protein -
  K5638_RS11590 (TUM17382_22940) - 2590537..2590716 (+) 180 WP_221059855.1 PA3496 family putative envelope integrity protein -
  K5638_RS11595 (TUM17382_22950) - 2590791..2591045 (+) 255 WP_259663279.1 hypothetical protein -
  K5638_RS11600 (TUM17382_22960) - 2591089..2591946 (+) 858 WP_221059856.1 phage N-6-adenine-methyltransferase -
  K5638_RS11605 (TUM17382_22970) - 2591927..2593672 (+) 1746 WP_221059857.1 DNA cytosine methyltransferase -
  K5638_RS22640 - 2593975..2594100 (+) 126 WP_259663280.1 hypothetical protein -
  K5638_RS11610 (TUM17382_23000) - 2594091..2594468 (+) 378 WP_221059858.1 hypothetical protein -
  K5638_RS11615 (TUM17382_23010) - 2594468..2594761 (+) 294 WP_259663281.1 hypothetical protein -
  K5638_RS11620 (TUM17382_23020) - 2594765..2595424 (+) 660 WP_221059859.1 hypothetical protein -
  K5638_RS11625 (TUM17382_23030) - 2595443..2595658 (+) 216 WP_221059860.1 hypothetical protein -
  K5638_RS11630 (TUM17382_23050) - 2596042..2596290 (+) 249 WP_144380172.1 DUF4224 domain-containing protein -
  K5638_RS11635 (TUM17382_23060) - 2596294..2597304 (+) 1011 WP_259663282.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 176 a.a.        Molecular weight: 19914.27 Da        Isoelectric Point: 6.8637

>NTDB_id=86584 K5638_RS11495 WP_221059840.1 2578072..2578602(-) (ssb) [Shewanella algae strain TUM17382]
MAHRGVNKVILVGNLGQDPEVRYMPNGNAVANINVATSESWKDQQGQQQERTEWHRIVMYGKLAEIAGEYLRKGSQVYLE
GKLQTRKWKDSSGVERFTTEVVIDQRGTMQMLGSRPENHQHGGNQRPEPQQNQGYAPKPQQQPQPQNYTPDLGEGWDDDI
PFAPIGKQYPALLLCC

Nucleotide


Download         Length: 531 bp        

>NTDB_id=86584 K5638_RS11495 WP_221059840.1 2578072..2578602(-) (ssb) [Shewanella algae strain TUM17382]
ATGGCACATAGAGGTGTAAACAAAGTCATTCTGGTTGGAAACCTTGGTCAGGATCCTGAGGTGCGCTACATGCCCAACGG
CAACGCTGTGGCAAATATCAACGTGGCCACCAGTGAGTCATGGAAGGACCAACAGGGCCAACAGCAAGAGCGTACCGAGT
GGCACAGGATCGTCATGTACGGGAAGTTGGCCGAAATTGCCGGTGAGTACCTGCGCAAAGGCTCGCAAGTGTATCTGGAA
GGCAAGCTTCAGACCCGCAAGTGGAAAGATAGCTCTGGAGTCGAGCGATTCACTACTGAGGTCGTGATTGACCAGCGCGG
AACGATGCAGATGCTCGGCAGTCGTCCTGAAAACCATCAGCATGGTGGCAACCAAAGGCCAGAGCCTCAGCAAAACCAAG
GTTATGCGCCAAAGCCACAGCAGCAACCACAACCACAAAACTACACGCCTGATCTGGGTGAAGGTTGGGATGATGACATC
CCGTTTGCACCGATTGGGAAGCAATACCCAGCGCTATTACTTTGCTGCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-111)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

57.542

100

0.585
  ssb Glaesserella parasuis strain SC1401

50.82

100

0.528
  ssb Neisseria gonorrhoeae MS11

48.864

100

0.489
  ssb Neisseria meningitidis MC58

47.429

99.432

0.472

Multiple sequence alignment