Detailed information
Bioinformatically predicted
Overview
| Name | comW | Type | Regulator |
| Locus tag | Q7621_RS00115 | Genome accession | NZ_CP131712 |
| Coordinates | 22170..22406 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939545.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 2008C09-280 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12175..60222 | 22170..22406 | within | 0 |
| IScluster/Tn | 20226..21853 | 22170..22406 | flank | 317 |
Gene organization within MGE regions
Location: 12175..60222
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q7621_RS00065 (Q7621_00065) | ftsH | 12175..14133 (+) | 1959 | WP_000744545.1 | ATP-dependent zinc metalloprotease FtsH | - |
| Q7621_RS00070 (Q7621_00070) | comX/comX2 | 14255..14734 (+) | 480 | WP_000588897.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| Q7621_RS00105 (Q7621_00105) | - | 20226..21072 (+) | 847 | Protein_14 | IS630 family transposase | - |
| Q7621_RS00110 (Q7621_00110) | - | 21107..21904 (-) | 798 | Protein_15 | transposase | - |
| Q7621_RS00115 (Q7621_00115) | comW | 22170..22406 (+) | 237 | WP_000939545.1 | sigma(X)-activator ComW | Regulator |
| Q7621_RS00120 (Q7621_00120) | - | 22637..23923 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| Q7621_RS00125 (Q7621_00125) | tadA | 24124..24591 (+) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| Q7621_RS00135 (Q7621_00135) | - | 24800..25498 (-) | 699 | WP_001106362.1 | site-specific integrase | - |
| Q7621_RS00140 (Q7621_00140) | - | 25588..25935 (-) | 348 | WP_001839379.1 | hypothetical protein | - |
| Q7621_RS00145 (Q7621_00145) | - | 25996..27065 (-) | 1070 | Protein_21 | type I restriction endonuclease | - |
| Q7621_RS00150 (Q7621_00150) | - | 27082..27462 (-) | 381 | WP_000170931.1 | ImmA/IrrE family metallo-endopeptidase | - |
| Q7621_RS00155 (Q7621_00155) | - | 27475..27738 (-) | 264 | WP_000285962.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| Q7621_RS00160 (Q7621_00160) | - | 27738..27971 (-) | 234 | WP_000156419.1 | hypothetical protein | - |
| Q7621_RS00165 (Q7621_00165) | - | 27971..28339 (-) | 369 | WP_000464160.1 | helix-turn-helix transcriptional regulator | - |
| Q7621_RS00170 (Q7621_00170) | - | 28911..29102 (+) | 192 | WP_001112859.1 | DNA-binding protein | - |
| Q7621_RS00175 (Q7621_00175) | - | 29125..29328 (+) | 204 | WP_001247549.1 | hypothetical protein | - |
| Q7621_RS00180 (Q7621_00180) | - | 29483..29650 (-) | 168 | WP_000024181.1 | YjzC family protein | - |
| Q7621_RS00185 (Q7621_00185) | - | 29670..30035 (+) | 366 | Protein_29 | autolysin | - |
| Q7621_RS00190 (Q7621_00190) | - | 30255..30434 (-) | 180 | WP_001209433.1 | hypothetical protein | - |
| Q7621_RS00195 (Q7621_00195) | - | 30576..30725 (-) | 150 | WP_001030863.1 | hypothetical protein | - |
| Q7621_RS00200 (Q7621_00200) | - | 31030..31473 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| Q7621_RS00205 (Q7621_00205) | - | 31475..31990 (+) | 516 | WP_000691236.1 | histidine phosphatase family protein | - |
| Q7621_RS00210 (Q7621_00210) | radA | 32004..33365 (+) | 1362 | WP_075213698.1 | DNA repair protein RadA | Machinery gene |
| Q7621_RS00215 (Q7621_00215) | - | 33438..33935 (+) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| Q7621_RS00220 (Q7621_00220) | - | 33960..34743 (+) | 784 | Protein_36 | PrsW family glutamic-type intramembrane protease | - |
| Q7621_RS00225 (Q7621_00225) | - | 34888..35856 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| Q7621_RS00230 (Q7621_00230) | - | 35974..36901 (+) | 928 | Protein_38 | Rpn family recombination-promoting nuclease/putative transposase | - |
| Q7621_RS00235 (Q7621_00235) | polA | 37510..40143 (+) | 2634 | WP_001812055.1 | DNA polymerase I | - |
| Q7621_RS00240 (Q7621_00240) | - | 40228..40665 (+) | 438 | WP_000076479.1 | CoA-binding protein | - |
| Q7621_RS00245 (Q7621_00245) | - | 40706..40921 (+) | 216 | WP_001814139.1 | hypothetical protein | - |
| Q7621_RS00250 (Q7621_00250) | - | 40940..41950 (-) | 1011 | WP_000009180.1 | YeiH family protein | - |
| Q7621_RS00255 (Q7621_00255) | - | 42099..43268 (+) | 1170 | WP_000366348.1 | pyridoxal phosphate-dependent aminotransferase | - |
| Q7621_RS00260 (Q7621_00260) | recO | 43265..44035 (+) | 771 | WP_000616164.1 | DNA repair protein RecO | - |
| Q7621_RS00265 (Q7621_00265) | plsX | 44032..45024 (+) | 993 | WP_000717451.1 | phosphate acyltransferase PlsX | - |
| Q7621_RS00270 (Q7621_00270) | - | 45030..45263 (+) | 234 | WP_000136449.1 | acyl carrier protein | - |
| Q7621_RS00275 (Q7621_00275) | - | 45309..45600 (+) | 292 | Protein_47 | IS5/IS1182 family transposase | - |
| Q7621_RS00280 (Q7621_00280) | blpU | 45802..46032 (+) | 231 | WP_001093075.1 | bacteriocin-like peptide BlpU | - |
| Q7621_RS00285 (Q7621_00285) | - | 46035..46160 (+) | 126 | WP_000346297.1 | PncF family bacteriocin immunity protein | - |
| Q7621_RS00290 (Q7621_00290) | comA | 46747..48900 (+) | 2154 | WP_341966606.1 | peptide cleavage/export ABC transporter ComA | Regulator |
| Q7621_RS00295 (Q7621_00295) | comB | 48913..50262 (+) | 1350 | WP_000801611.1 | competence pheromone export protein ComB | Regulator |
| Q7621_RS00300 (Q7621_00300) | purC | 50432..51139 (+) | 708 | WP_000043310.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| Q7621_RS00305 (Q7621_00305) | - | 51196..54921 (+) | 3726 | WP_000361217.1 | phosphoribosylformylglycinamidine synthase | - |
| Q7621_RS00310 (Q7621_00310) | purF | 55014..56456 (+) | 1443 | WP_000220632.1 | amidophosphoribosyltransferase | - |
| Q7621_RS00315 (Q7621_00315) | purM | 56493..57515 (+) | 1023 | WP_000182575.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| Q7621_RS00320 (Q7621_00320) | purN | 57512..58057 (+) | 546 | WP_000717506.1 | phosphoribosylglycinamide formyltransferase | - |
| Q7621_RS00325 (Q7621_00325) | - | 58141..58650 (+) | 510 | WP_000894018.1 | VanZ family protein | - |
| Q7621_RS00330 (Q7621_00330) | purH | 58675..60222 (+) | 1548 | WP_000167083.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9658.13 Da Isoelectric Point: 6.7051
>NTDB_id=864242 Q7621_RS00115 WP_000939545.1 22170..22406(+) (comW) [Streptococcus pneumoniae strain 2008C09-280]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=864242 Q7621_RS00115 WP_000939545.1 22170..22406(+) (comW) [Streptococcus pneumoniae strain 2008C09-280]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAAGGATTTTA
TTGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGGTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAAGGATTTTA
TTGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGGTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comW | Streptococcus mitis SK321 |
75.641 |
100 |
0.756 |
| comW | Streptococcus mitis NCTC 12261 |
75.325 |
98.718 |
0.744 |