Detailed information
Bioinformatically predicted
Overview
| Name | comW | Type | Regulator |
| Locus tag | Q7625_RS00115 | Genome accession | NZ_CP131708 |
| Coordinates | 22169..22405 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939545.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 2016C10-332 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12174..60221 | 22169..22405 | within | 0 |
| IScluster/Tn | 20225..21852 | 22169..22405 | flank | 317 |
Gene organization within MGE regions
Location: 12174..60221
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q7625_RS00065 (Q7625_00065) | ftsH | 12174..14132 (+) | 1959 | WP_000744545.1 | ATP-dependent zinc metalloprotease FtsH | - |
| Q7625_RS00070 (Q7625_00070) | comX/comX2 | 14254..14733 (+) | 480 | WP_000588897.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| Q7625_RS00105 (Q7625_00105) | - | 20225..21071 (+) | 847 | Protein_14 | IS630 family transposase | - |
| Q7625_RS00110 (Q7625_00110) | - | 21106..21903 (-) | 798 | Protein_15 | transposase | - |
| Q7625_RS00115 (Q7625_00115) | comW | 22169..22405 (+) | 237 | WP_000939545.1 | sigma(X)-activator ComW | Regulator |
| Q7625_RS00120 (Q7625_00120) | - | 22636..23922 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| Q7625_RS00125 (Q7625_00125) | tadA | 24123..24590 (+) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| Q7625_RS00135 (Q7625_00135) | - | 24799..25497 (-) | 699 | WP_001106362.1 | site-specific integrase | - |
| Q7625_RS00140 (Q7625_00140) | - | 25587..25934 (-) | 348 | WP_001839379.1 | hypothetical protein | - |
| Q7625_RS00145 (Q7625_00145) | - | 25995..27064 (-) | 1070 | Protein_21 | type I restriction endonuclease | - |
| Q7625_RS00150 (Q7625_00150) | - | 27081..27461 (-) | 381 | WP_000170931.1 | ImmA/IrrE family metallo-endopeptidase | - |
| Q7625_RS00155 (Q7625_00155) | - | 27474..27737 (-) | 264 | WP_000285962.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| Q7625_RS00160 (Q7625_00160) | - | 27737..27970 (-) | 234 | WP_000156419.1 | hypothetical protein | - |
| Q7625_RS00165 (Q7625_00165) | - | 27970..28338 (-) | 369 | WP_000464160.1 | helix-turn-helix transcriptional regulator | - |
| Q7625_RS00170 (Q7625_00170) | - | 28910..29101 (+) | 192 | WP_001112859.1 | DNA-binding protein | - |
| Q7625_RS00175 (Q7625_00175) | - | 29124..29327 (+) | 204 | WP_001247549.1 | hypothetical protein | - |
| Q7625_RS00180 (Q7625_00180) | - | 29482..29649 (-) | 168 | WP_000024181.1 | YjzC family protein | - |
| Q7625_RS00185 (Q7625_00185) | - | 29669..30034 (+) | 366 | Protein_29 | autolysin | - |
| Q7625_RS00190 (Q7625_00190) | - | 30254..30433 (-) | 180 | WP_001209433.1 | hypothetical protein | - |
| Q7625_RS00195 (Q7625_00195) | - | 30575..30724 (-) | 150 | WP_001030863.1 | hypothetical protein | - |
| Q7625_RS00200 (Q7625_00200) | - | 31029..31472 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| Q7625_RS00205 (Q7625_00205) | - | 31474..31989 (+) | 516 | WP_000691236.1 | histidine phosphatase family protein | - |
| Q7625_RS00210 (Q7625_00210) | radA | 32003..33364 (+) | 1362 | WP_075213698.1 | DNA repair protein RadA | Machinery gene |
| Q7625_RS00215 (Q7625_00215) | - | 33437..33934 (+) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| Q7625_RS00220 (Q7625_00220) | - | 33959..34742 (+) | 784 | Protein_36 | PrsW family glutamic-type intramembrane protease | - |
| Q7625_RS00225 (Q7625_00225) | - | 34887..35855 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| Q7625_RS00230 (Q7625_00230) | - | 35973..36900 (+) | 928 | Protein_38 | Rpn family recombination-promoting nuclease/putative transposase | - |
| Q7625_RS00235 (Q7625_00235) | polA | 37509..40142 (+) | 2634 | WP_001812055.1 | DNA polymerase I | - |
| Q7625_RS00240 (Q7625_00240) | - | 40227..40664 (+) | 438 | WP_000076479.1 | CoA-binding protein | - |
| Q7625_RS00245 (Q7625_00245) | - | 40705..40920 (+) | 216 | WP_001814139.1 | hypothetical protein | - |
| Q7625_RS00250 (Q7625_00250) | - | 40939..41949 (-) | 1011 | WP_000009180.1 | YeiH family protein | - |
| Q7625_RS00255 (Q7625_00255) | - | 42098..43267 (+) | 1170 | WP_000366348.1 | pyridoxal phosphate-dependent aminotransferase | - |
| Q7625_RS00260 (Q7625_00260) | recO | 43264..44034 (+) | 771 | WP_000616164.1 | DNA repair protein RecO | - |
| Q7625_RS00265 (Q7625_00265) | plsX | 44031..45023 (+) | 993 | WP_000717451.1 | phosphate acyltransferase PlsX | - |
| Q7625_RS00270 (Q7625_00270) | - | 45029..45262 (+) | 234 | WP_000136449.1 | acyl carrier protein | - |
| Q7625_RS00275 (Q7625_00275) | - | 45308..45599 (+) | 292 | Protein_47 | IS5/IS1182 family transposase | - |
| Q7625_RS00280 (Q7625_00280) | blpU | 45801..46031 (+) | 231 | WP_001093075.1 | bacteriocin-like peptide BlpU | - |
| Q7625_RS00285 (Q7625_00285) | - | 46034..46159 (+) | 126 | WP_000346297.1 | PncF family bacteriocin immunity protein | - |
| Q7625_RS00290 (Q7625_00290) | comA | 46746..48899 (+) | 2154 | WP_000668272.1 | peptide cleavage/export ABC transporter ComA | Regulator |
| Q7625_RS00295 (Q7625_00295) | comB | 48912..50261 (+) | 1350 | WP_000801611.1 | competence pheromone export protein ComB | Regulator |
| Q7625_RS00300 (Q7625_00300) | purC | 50431..51138 (+) | 708 | WP_000043310.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| Q7625_RS00305 (Q7625_00305) | - | 51195..54920 (+) | 3726 | WP_000361217.1 | phosphoribosylformylglycinamidine synthase | - |
| Q7625_RS00310 (Q7625_00310) | purF | 55013..56455 (+) | 1443 | WP_000220632.1 | amidophosphoribosyltransferase | - |
| Q7625_RS00315 (Q7625_00315) | purM | 56492..57514 (+) | 1023 | WP_000182575.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| Q7625_RS00320 (Q7625_00320) | purN | 57511..58056 (+) | 546 | WP_000717506.1 | phosphoribosylglycinamide formyltransferase | - |
| Q7625_RS00325 (Q7625_00325) | - | 58140..58649 (+) | 510 | WP_000894018.1 | VanZ family protein | - |
| Q7625_RS00330 (Q7625_00330) | purH | 58674..60221 (+) | 1548 | WP_341922723.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9658.13 Da Isoelectric Point: 6.7051
>NTDB_id=863935 Q7625_RS00115 WP_000939545.1 22169..22405(+) (comW) [Streptococcus pneumoniae strain 2016C10-332]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=863935 Q7625_RS00115 WP_000939545.1 22169..22405(+) (comW) [Streptococcus pneumoniae strain 2016C10-332]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAAGGATTTTA
TTGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGGTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAAGGATTTTA
TTGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGGTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comW | Streptococcus mitis SK321 |
75.641 |
100 |
0.756 |
| comW | Streptococcus mitis NCTC 12261 |
75.325 |
98.718 |
0.744 |