Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | Q7636_RS01720 | Genome accession | NZ_CP131668 |
| Coordinates | 382482..382985 (+) | Length | 167 a.a. |
| NCBI ID | WP_000934799.1 | Uniprot ID | A0A7U7IE99 |
| Organism | Staphylococcus aureus strain 2004S09-216 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 378419..404133 | 382482..382985 | within | 0 |
Gene organization within MGE regions
Location: 378419..404133
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q7636_RS01690 (Q7636_01685) | - | 378419..379264 (+) | 846 | WP_001550052.1 | ParB/RepB/Spo0J family partition protein | - |
| Q7636_RS01695 (Q7636_01690) | - | 379421..380302 (+) | 882 | WP_001077602.1 | mechanosensitive ion channel family protein | - |
| Q7636_RS01700 (Q7636_01695) | - | 380332..380535 (+) | 204 | WP_000157345.1 | DUF951 domain-containing protein | - |
| Q7636_RS01705 (Q7636_01700) | ychF | 380547..381644 (+) | 1098 | WP_001218732.1 | redox-regulated ATPase YchF | - |
| Q7636_RS01710 (Q7636_01705) | - | 381730..381921 (-) | 192 | WP_001052483.1 | hypothetical protein | - |
| Q7636_RS01715 (Q7636_01710) | rpsF | 382165..382461 (+) | 297 | WP_001261460.1 | 30S ribosomal protein S6 | - |
| Q7636_RS01720 (Q7636_01715) | ssbA | 382482..382985 (+) | 504 | WP_000934799.1 | single-stranded DNA-binding protein | Machinery gene |
| Q7636_RS01725 (Q7636_01720) | rpsR | 383037..383279 (+) | 243 | WP_000897044.1 | 30S ribosomal protein S18 | - |
| Q7636_RS01730 (Q7636_01725) | - | 383461..384291 (-) | 831 | WP_000357934.1 | KilA-N domain-containing protein | - |
| Q7636_RS01735 (Q7636_01730) | - | 384774..385991 (-) | 1218 | WP_000270130.1 | site-specific integrase | - |
| Q7636_RS01740 (Q7636_01735) | - | 386447..387142 (-) | 696 | WP_000668212.1 | helix-turn-helix domain-containing protein | - |
| Q7636_RS01745 (Q7636_01740) | - | 387286..387498 (+) | 213 | WP_000794656.1 | helix-turn-helix transcriptional regulator | - |
| Q7636_RS01750 (Q7636_01745) | - | 387499..387771 (+) | 273 | WP_000091734.1 | helix-turn-helix domain-containing protein | - |
| Q7636_RS01755 (Q7636_01750) | - | 387783..387929 (+) | 147 | WP_031824147.1 | hypothetical protein | - |
| Q7636_RS01760 (Q7636_01755) | - | 387922..388131 (+) | 210 | WP_001058486.1 | hypothetical protein | - |
| Q7636_RS01765 (Q7636_01760) | - | 388134..388451 (+) | 318 | WP_001103936.1 | DUF1474 family protein | - |
| Q7636_RS01770 (Q7636_01765) | - | 388515..389384 (+) | 870 | WP_001002700.1 | primase alpha helix C-terminal domain-containing protein | - |
| Q7636_RS01775 (Q7636_01770) | - | 389401..390870 (+) | 1470 | WP_001795628.1 | virulence-associated E family protein | - |
| Q7636_RS01780 (Q7636_01775) | - | 391156..391518 (+) | 363 | WP_108932420.1 | pathogenicity island protein | - |
| Q7636_RS01785 (Q7636_01780) | - | 391520..391804 (+) | 285 | WP_000998182.1 | hypothetical protein | - |
| Q7636_RS01790 (Q7636_01785) | - | 391801..392442 (+) | 642 | WP_001019769.1 | hypothetical protein | - |
| Q7636_RS01795 (Q7636_01790) | - | 392789..393130 (+) | 342 | WP_001161659.1 | hypothetical protein | - |
| Q7636_RS01800 (Q7636_01795) | - | 393142..393720 (+) | 579 | WP_000846292.1 | hypothetical protein | - |
| Q7636_RS01805 (Q7636_01800) | - | 393738..393956 (+) | 219 | WP_000448775.1 | capsid morphogenesis B protein | - |
| Q7636_RS01810 (Q7636_01805) | - | 394007..394534 (+) | 528 | WP_000771356.1 | spore coat protein | - |
| Q7636_RS01815 (Q7636_01810) | - | 394537..394878 (+) | 342 | WP_000358778.1 | hypothetical protein | - |
| Q7636_RS01820 (Q7636_01815) | - | 394875..395444 (+) | 570 | WP_001293080.1 | terminase small subunit | - |
| Q7636_RS01825 (Q7636_01820) | - | 395491..395574 (+) | 84 | Protein_362 | terminase small subunit | - |
| Q7636_RS01830 (Q7636_01825) | - | 395721..396689 (+) | 969 | WP_000801979.1 | Abi family protein | - |
| Q7636_RS01835 (Q7636_01830) | - | 397173..397294 (+) | 122 | Protein_364 | hypothetical protein | - |
| Q7636_RS01840 (Q7636_01835) | - | 397537..397689 (+) | 153 | WP_001795626.1 | hypothetical protein | - |
| Q7636_RS01845 (Q7636_01840) | - | 397760..397870 (+) | 111 | WP_000139423.1 | hypothetical protein | - |
| Q7636_RS01850 (Q7636_01845) | - | 397872..398057 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
| Q7636_RS01855 (Q7636_01850) | - | 399196..400134 (-) | 939 | WP_001822249.1 | Abi family protein | - |
| Q7636_RS01860 (Q7636_01855) | - | 400173..400880 (-) | 708 | Protein_369 | tyrosine-type recombinase/integrase | - |
| Q7636_RS01865 (Q7636_01860) | selX | 401080..401691 (+) | 612 | WP_000475326.1 | staphylococcal enterotoxin-like toxin X | - |
| Q7636_RS01870 (Q7636_01865) | - | 402060..402428 (+) | 369 | WP_108932421.1 | YxeA family protein | - |
| Q7636_RS01875 (Q7636_01870) | - | 402609..403181 (+) | 573 | WP_000769720.1 | PepSY domain-containing protein | - |
| Q7636_RS01880 (Q7636_01875) | - | 403319..403582 (-) | 264 | WP_001055897.1 | helix-turn-helix transcriptional regulator | - |
| Q7636_RS01885 (Q7636_01880) | - | 403882..404133 (+) | 252 | WP_000466748.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
Sequence
Protein
Download Length: 167 a.a. Molecular weight: 18539.12 Da Isoelectric Point: 4.7305
>NTDB_id=863552 Q7636_RS01720 WP_000934799.1 382482..382985(+) (ssbA) [Staphylococcus aureus strain 2004S09-216]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF
Nucleotide
Download Length: 504 bp
>NTDB_id=863552 Q7636_RS01720 WP_000934799.1 382482..382985(+) (ssbA) [Staphylococcus aureus strain 2004S09-216]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
65.341 |
100 |
0.689 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.971 |
100 |
0.563 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
63.473 |
0.371 |
| ssb | Glaesserella parasuis strain SC1401 |
34.463 |
100 |
0.365 |