Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | Q7640_RS01665 | Genome accession | NZ_CP131659 |
| Coordinates | 376799..377269 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain 2010N21-057 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 366214..408710 | 376799..377269 | within | 0 |
Gene organization within MGE regions
Location: 366214..408710
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q7640_RS01580 (Q7640_01580) | - | 366214..367419 (-) | 1206 | WP_000264186.1 | tyrosine-type recombinase/integrase | - |
| Q7640_RS01585 (Q7640_01585) | - | 367530..367709 (+) | 180 | WP_000337826.1 | hypothetical protein | - |
| Q7640_RS01590 (Q7640_01590) | - | 367689..368621 (-) | 933 | WP_000392181.1 | hypothetical protein | - |
| Q7640_RS01595 (Q7640_01595) | - | 368653..369378 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| Q7640_RS01600 (Q7640_01600) | - | 369406..370080 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| Q7640_RS01605 (Q7640_01605) | - | 370097..370429 (-) | 333 | WP_001055143.1 | helix-turn-helix transcriptional regulator | - |
| Q7640_RS01610 (Q7640_01610) | - | 370692..370886 (+) | 195 | WP_000108122.1 | helix-turn-helix transcriptional regulator | - |
| Q7640_RS01615 (Q7640_01615) | - | 370886..371653 (+) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| Q7640_RS01620 (Q7640_01620) | - | 371654..371878 (+) | 225 | WP_000187184.1 | hypothetical protein | - |
| Q7640_RS01625 (Q7640_01625) | - | 371918..372016 (+) | 99 | Protein_322 | hypothetical protein | - |
| Q7640_RS01630 (Q7640_01630) | - | 372166..372429 (+) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| Q7640_RS01635 (Q7640_01635) | - | 372441..372602 (+) | 162 | WP_000066021.1 | DUF1270 family protein | - |
| Q7640_RS01640 (Q7640_01640) | - | 372694..372954 (+) | 261 | WP_000291089.1 | DUF1108 family protein | - |
| Q7640_RS01645 (Q7640_01645) | - | 372963..373226 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| Q7640_RS01650 (Q7640_01650) | - | 373235..375178 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| Q7640_RS01655 (Q7640_01655) | - | 375180..376100 (+) | 921 | WP_000180598.1 | recombinase RecT | - |
| Q7640_RS01660 (Q7640_01660) | - | 376181..376798 (+) | 618 | WP_064135358.1 | MBL fold metallo-hydrolase | - |
| Q7640_RS01665 (Q7640_01665) | ssbA | 376799..377269 (+) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| Q7640_RS01670 (Q7640_01670) | - | 377299..378192 (+) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| Q7640_RS01675 (Q7640_01675) | - | 378199..378417 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| Q7640_RS01680 (Q7640_01680) | - | 378426..378830 (+) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| Q7640_RS01685 (Q7640_01685) | - | 378843..379215 (+) | 373 | Protein_334 | SA1788 family PVL leukocidin-associated protein | - |
| Q7640_RS01690 (Q7640_01690) | - | 379215..379472 (+) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| Q7640_RS01695 (Q7640_01695) | - | 379469..379717 (+) | 249 | WP_000178986.1 | SAV1978 family virulence-associated passenger protein | - |
| Q7640_RS01700 (Q7640_01700) | - | 379730..380131 (+) | 402 | WP_000695762.1 | hypothetical protein | - |
| Q7640_RS01705 (Q7640_01705) | - | 380128..380475 (+) | 348 | WP_072482945.1 | YopX family protein | - |
| Q7640_RS01710 (Q7640_01710) | - | 380472..380780 (+) | 309 | WP_000144710.1 | hypothetical protein | - |
| Q7640_RS01715 (Q7640_01715) | - | 380773..381021 (+) | 249 | WP_001065026.1 | DUF1024 family protein | - |
| Q7640_RS01720 (Q7640_01720) | - | 381014..381550 (+) | 537 | WP_000185663.1 | dUTPase | - |
| Q7640_RS01725 (Q7640_01725) | - | 381587..381787 (+) | 201 | WP_000195821.1 | DUF1381 domain-containing protein | - |
| Q7640_RS01730 (Q7640_01730) | - | 381886..382122 (+) | 237 | WP_000608279.1 | hypothetical protein | - |
| Q7640_RS01735 (Q7640_01735) | - | 382115..382288 (+) | 174 | WP_000591891.1 | transcriptional activator RinB | - |
| Q7640_RS01740 (Q7640_01740) | - | 382289..382654 (+) | 366 | WP_000989954.1 | hypothetical protein | - |
| Q7640_RS01745 (Q7640_01745) | - | 382655..382801 (+) | 147 | WP_000989960.1 | hypothetical protein | - |
| Q7640_RS01750 (Q7640_01750) | - | 382825..383265 (+) | 441 | WP_000162703.1 | RinA family phage transcriptional activator | - |
| Q7640_RS01755 (Q7640_01755) | - | 383576..384070 (+) | 495 | WP_000594082.1 | terminase small subunit | - |
| Q7640_RS01760 (Q7640_01760) | - | 384063..385271 (+) | 1209 | WP_001606760.1 | PBSX family phage terminase large subunit | - |
| Q7640_RS01765 (Q7640_01765) | - | 385225..386703 (+) | 1479 | WP_001159668.1 | phage portal protein | - |
| Q7640_RS01770 (Q7640_01770) | - | 386642..387625 (+) | 984 | WP_014532414.1 | phage head morphogenesis protein | - |
| Q7640_RS01775 (Q7640_01775) | - | 387627..387833 (+) | 207 | WP_000346033.1 | hypothetical protein | - |
| Q7640_RS01780 (Q7640_01780) | - | 387938..388534 (+) | 597 | WP_000366932.1 | phage scaffolding protein | - |
| Q7640_RS01785 (Q7640_01785) | - | 388555..389379 (+) | 825 | WP_001135558.1 | N4-gp56 family major capsid protein | - |
| Q7640_RS01790 (Q7640_01790) | - | 389396..389722 (+) | 327 | WP_000278799.1 | Rho termination factor N-terminal domain-containing protein | - |
| Q7640_RS01795 (Q7640_01795) | - | 389722..390036 (+) | 315 | WP_000338935.1 | phage head-tail connector protein | - |
| Q7640_RS01800 (Q7640_01800) | - | 390029..390364 (+) | 336 | WP_017431444.1 | phage head closure protein | - |
| Q7640_RS01805 (Q7640_01805) | - | 390351..390764 (+) | 414 | WP_001151335.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| Q7640_RS01810 (Q7640_01810) | - | 390777..391214 (+) | 438 | WP_000270196.1 | DUF3168 domain-containing protein | - |
| Q7640_RS01815 (Q7640_01815) | - | 391201..391761 (+) | 561 | WP_000046067.1 | hypothetical protein | - |
| Q7640_RS01820 (Q7640_01820) | - | 391823..392317 (+) | 495 | WP_000141082.1 | tail assembly chaperone | - |
| Q7640_RS01825 (Q7640_01825) | - | 392338..392679 (+) | 342 | WP_001580347.1 | hypothetical protein | - |
| Q7640_RS01830 (Q7640_01830) | - | 392682..395651 (+) | 2970 | WP_000414234.1 | terminase | - |
| Q7640_RS01835 (Q7640_01835) | - | 395666..396601 (+) | 936 | WP_000560193.1 | phage tail domain-containing protein | - |
| Q7640_RS01840 (Q7640_01840) | - | 396612..398495 (+) | 1884 | WP_001144702.1 | SGNH/GDSL hydrolase family protein | - |
| Q7640_RS01845 (Q7640_01845) | - | 398508..400406 (+) | 1899 | WP_000323252.1 | hypothetical protein | - |
| Q7640_RS01850 (Q7640_01850) | - | 400406..402229 (+) | 1824 | WP_000259636.1 | BppU family phage baseplate upper protein | - |
| Q7640_RS01855 (Q7640_01855) | - | 402229..402606 (+) | 378 | WP_000869363.1 | DUF2977 domain-containing protein | - |
| Q7640_RS01860 (Q7640_01860) | - | 402616..402789 (+) | 174 | WP_015990323.1 | XkdX family protein | - |
| Q7640_RS01865 (Q7640_01865) | - | 402830..403129 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| Q7640_RS01870 (Q7640_01870) | - | 403266..405140 (+) | 1875 | WP_000524040.1 | glucosaminidase domain-containing protein | - |
| Q7640_RS01875 (Q7640_01875) | - | 405153..406391 (+) | 1239 | WP_000276640.1 | BppU family phage baseplate upper protein | - |
| Q7640_RS01880 (Q7640_01880) | - | 406396..406791 (+) | 396 | WP_000387945.1 | hypothetical protein | - |
| Q7640_RS01885 (Q7640_01885) | - | 406847..407284 (+) | 438 | WP_000354132.1 | phage holin | - |
| Q7640_RS01890 (Q7640_01890) | - | 407265..408710 (+) | 1446 | WP_341973704.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=863374 Q7640_RS01665 WP_000934759.1 376799..377269(+) (ssbA) [Staphylococcus aureus strain 2010N21-057]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=863374 Q7640_RS01665 WP_000934759.1 376799..377269(+) (ssbA) [Staphylococcus aureus strain 2010N21-057]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |