Detailed information
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | Q6385_RS02350 | Genome accession | NZ_CP130893 |
| Coordinates | 449959..450432 (+) | Length | 157 a.a. |
| NCBI ID | WP_176549690.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain NJ1914646 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 445446..502419 | 449959..450432 | within | 0 |
Gene organization within MGE regions
Location: 445446..502419
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q6385_RS02325 (Q6385_02325) | dnaB | 445446..446849 (+) | 1404 | WP_050169725.1 | replicative DNA helicase | - |
| Q6385_RS02330 (Q6385_02330) | pilH | 447106..447768 (+) | 663 | WP_041421240.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| Q6385_RS02335 (Q6385_02335) | pilI | 447800..448411 (+) | 612 | WP_139591885.1 | type IV pilus modification protein PilV | Machinery gene |
| Q6385_RS02340 (Q6385_02340) | pilJ | 448408..449367 (+) | 960 | WP_050169726.1 | PilW family protein | Machinery gene |
| Q6385_RS02345 (Q6385_02345) | pilK | 449346..449957 (+) | 612 | WP_012503481.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| Q6385_RS02350 (Q6385_02350) | pilL | 449959..450432 (+) | 474 | WP_176549690.1 | PilX family type IV pilin | Machinery gene |
| Q6385_RS02355 (Q6385_02355) | - | 450502..450810 (-) | 309 | WP_003706588.1 | AzlD family protein | - |
| Q6385_RS02360 (Q6385_02360) | - | 450807..451518 (-) | 712 | Protein_460 | AzlC family ABC transporter permease | - |
| Q6385_RS02365 (Q6385_02365) | dut | 451684..452136 (+) | 453 | WP_003701071.1 | dUTP diphosphatase | - |
| Q6385_RS02370 (Q6385_02370) | dapC | 452208..453395 (+) | 1188 | WP_003701073.1 | succinyldiaminopimelate transaminase | - |
| Q6385_RS02375 (Q6385_02375) | yaaA | 453551..454330 (+) | 780 | WP_003706583.1 | peroxide stress protein YaaA | - |
| Q6385_RS02390 (Q6385_02390) | - | 454861..456054 (+) | 1194 | WP_010359935.1 | integrase arm-type DNA-binding domain-containing protein | - |
| Q6385_RS02395 (Q6385_02395) | - | 456410..456679 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| Q6385_RS02400 (Q6385_02400) | - | 456874..457557 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| Q6385_RS11740 | - | 457871..458104 (-) | 234 | Protein_467 | hypothetical protein | - |
| Q6385_RS02410 (Q6385_02410) | - | 458215..458430 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| Q6385_RS02415 (Q6385_02415) | - | 458482..458973 (-) | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| Q6385_RS02420 (Q6385_02420) | - | 458970..459152 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| Q6385_RS02425 (Q6385_02425) | - | 459292..459978 (-) | 687 | WP_050159915.1 | phage replication initiation protein, NGO0469 family | - |
| Q6385_RS02430 (Q6385_02430) | - | 460047..460208 (-) | 162 | WP_003693867.1 | hypothetical protein | - |
| Q6385_RS02435 (Q6385_02435) | - | 460205..460483 (-) | 279 | WP_003691529.1 | NGO1622 family putative holin | - |
| Q6385_RS02440 (Q6385_02440) | - | 460636..460968 (-) | 333 | WP_003687946.1 | hypothetical protein | - |
| Q6385_RS02445 (Q6385_02445) | - | 461109..461384 (-) | 276 | WP_103195391.1 | hypothetical protein | - |
| Q6385_RS02450 (Q6385_02450) | - | 461381..461857 (-) | 477 | WP_002255718.1 | hypothetical protein | - |
| Q6385_RS02455 (Q6385_02455) | - | 461890..462090 (-) | 201 | WP_047954343.1 | hypothetical protein | - |
| Q6385_RS02460 (Q6385_02460) | - | 462288..462701 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| Q6385_RS02465 (Q6385_02465) | - | 462698..463159 (-) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| Q6385_RS02470 (Q6385_02470) | - | 463176..463613 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| Q6385_RS02475 (Q6385_02475) | - | 463726..464442 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| Q6385_RS02480 (Q6385_02480) | - | 464511..464747 (+) | 237 | WP_003687971.1 | Cro/CI family transcriptional regulator | - |
| Q6385_RS02485 (Q6385_02485) | - | 464827..464982 (+) | 156 | WP_003689578.1 | hypothetical protein | - |
| Q6385_RS02490 (Q6385_02490) | - | 464959..465147 (-) | 189 | WP_003696008.1 | hypothetical protein | - |
| Q6385_RS02495 (Q6385_02495) | - | 465320..465547 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| Q6385_RS02500 (Q6385_02500) | - | 465544..465681 (+) | 138 | WP_010359998.1 | hypothetical protein | - |
| Q6385_RS02505 (Q6385_02505) | - | 466226..466729 (+) | 504 | WP_010360005.1 | hypothetical protein | - |
| Q6385_RS02510 (Q6385_02510) | - | 466726..468087 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| Q6385_RS02515 (Q6385_02515) | - | 468124..468387 (+) | 264 | WP_154235914.1 | hypothetical protein | - |
| Q6385_RS02520 (Q6385_02520) | - | 468426..468920 (+) | 495 | WP_003691434.1 | DUF3310 domain-containing protein | - |
| Q6385_RS02525 (Q6385_02525) | - | 469097..469246 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| Q6385_RS02530 (Q6385_02530) | - | 469275..469556 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| Q6385_RS02535 (Q6385_02535) | - | 469547..469927 (+) | 381 | WP_048596749.1 | RusA family crossover junction endodeoxyribonuclease | - |
| Q6385_RS02540 (Q6385_02540) | - | 469944..470072 (-) | 129 | WP_012503747.1 | hypothetical protein | - |
| Q6385_RS02545 (Q6385_02545) | - | 470194..470601 (+) | 408 | WP_103195307.1 | hypothetical protein | - |
| Q6385_RS02550 (Q6385_02550) | - | 470692..471852 (+) | 1161 | WP_047919575.1 | type I restriction endonuclease | - |
| Q6385_RS02555 (Q6385_02555) | - | 472133..473002 (+) | 870 | WP_103195306.1 | BRO family protein | - |
| Q6385_RS02560 (Q6385_02560) | - | 473295..473744 (+) | 450 | WP_003695485.1 | hypothetical protein | - |
| Q6385_RS02565 (Q6385_02565) | terL | 473806..475227 (+) | 1422 | WP_003697216.1 | phage terminase large subunit | - |
| Q6385_RS02570 (Q6385_02570) | - | 475224..477371 (+) | 2148 | WP_003691423.1 | phage portal protein | - |
| Q6385_RS02575 (Q6385_02575) | - | 477439..478596 (+) | 1158 | WP_047918052.1 | HK97 family phage prohead protease | - |
| Q6385_RS02580 (Q6385_02580) | - | 478637..480136 (+) | 1500 | WP_003691419.1 | hypothetical protein | - |
| Q6385_RS02585 (Q6385_02585) | - | 480143..480499 (+) | 357 | WP_003691418.1 | hypothetical protein | - |
| Q6385_RS02590 (Q6385_02590) | - | 480502..481032 (+) | 531 | WP_003689080.1 | head-tail connector protein | - |
| Q6385_RS02595 (Q6385_02595) | - | 481032..481514 (+) | 483 | WP_041421297.1 | HK97 gp10 family phage protein | - |
| Q6385_RS02600 (Q6385_02600) | - | 481511..481939 (+) | 429 | WP_003689076.1 | hypothetical protein | - |
| Q6385_RS02605 (Q6385_02605) | - | 481965..482738 (+) | 774 | WP_003692869.1 | hypothetical protein | - |
| Q6385_RS02610 (Q6385_02610) | - | 482799..483128 (+) | 330 | WP_003692871.1 | hypothetical protein | - |
| Q6385_RS02615 (Q6385_02615) | - | 483140..483406 (+) | 267 | WP_003689070.1 | hypothetical protein | - |
| Q6385_RS02620 (Q6385_02620) | - | 483406..484005 (+) | 600 | WP_003692874.1 | DUF2460 domain-containing protein | - |
| Q6385_RS02625 (Q6385_02625) | - | 484002..484856 (+) | 855 | WP_003698614.1 | DUF2163 domain-containing protein | - |
| Q6385_RS02630 (Q6385_02630) | - | 484858..485289 (+) | 432 | WP_003689064.1 | NlpC/P60 family protein | - |
| Q6385_RS02635 (Q6385_02635) | - | 485317..485595 (-) | 279 | WP_003689062.1 | helix-turn-helix domain-containing protein | - |
| Q6385_RS02640 (Q6385_02640) | - | 485835..489980 (+) | 4146 | WP_125121574.1 | phage tail protein | - |
| Q6385_RS02645 (Q6385_02645) | - | 490092..490397 (+) | 306 | WP_003689058.1 | hypothetical protein | - |
| Q6385_RS02650 (Q6385_02650) | - | 490468..490938 (+) | 471 | WP_003691410.1 | hypothetical protein | - |
| Q6385_RS02655 (Q6385_02655) | - | 490939..491271 (+) | 333 | WP_003691408.1 | hypothetical protein | - |
| Q6385_RS02660 (Q6385_02660) | - | 491399..491632 (-) | 234 | WP_003692884.1 | hypothetical protein | - |
| Q6385_RS02665 (Q6385_02665) | - | 491640..491987 (-) | 348 | WP_003689051.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| Q6385_RS02670 (Q6385_02670) | - | 491987..492223 (-) | 237 | WP_003689049.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| Q6385_RS02675 (Q6385_02675) | - | 492263..492388 (+) | 126 | WP_255294325.1 | hypothetical protein | - |
| Q6385_RS02680 (Q6385_02680) | - | 492430..492969 (+) | 540 | WP_103195302.1 | TIGR02594 family protein | - |
| Q6385_RS02685 (Q6385_02685) | - | 492969..493127 (+) | 159 | WP_003691816.1 | hypothetical protein | - |
| Q6385_RS02690 (Q6385_02690) | - | 493111..493452 (+) | 342 | WP_003696082.1 | hypothetical protein | - |
| Q6385_RS02695 (Q6385_02695) | - | 494129..497173 (+) | 3045 | WP_103195301.1 | tape measure protein | - |
| Q6385_RS02700 (Q6385_02700) | - | 497233..497712 (-) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| Q6385_RS02705 (Q6385_02705) | - | 498054..499043 (-) | 990 | WP_003689040.1 | site-specific integrase | - |
| Q6385_RS02710 (Q6385_02710) | - | 499303..499491 (-) | 189 | WP_003689039.1 | hypothetical protein | - |
| Q6385_RS02715 (Q6385_02715) | purM | 499732..500766 (+) | 1035 | WP_003692893.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| Q6385_RS02720 (Q6385_02720) | - | 501766..502419 (+) | 654 | WP_162855545.1 | IS1595 family transposase | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17514.36 Da Isoelectric Point: 10.0560
>NTDB_id=861782 Q6385_RS02350 WP_176549690.1 449959..450432(+) (pilL) [Neisseria gonorrhoeae strain NJ1914646]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRNATSARTYSETLSANTGCEAFSNRKK
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRNATSARTYSETLSANTGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=861782 Q6385_RS02350 WP_176549690.1 449959..450432(+) (pilL) [Neisseria gonorrhoeae strain NJ1914646]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGATCATCAAGAGCAAACTGGAAACATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCGGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGATCATCAAGAGCAAACTGGAAACATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCGGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
91.083 |
100 |
0.911 |
| pilX | Neisseria meningitidis 8013 |
85.987 |
100 |
0.86 |