Detailed information
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | LLWG2_RS11520 | Genome accession | NZ_CP129660 |
| Coordinates | 2221594..2221782 (-) | Length | 62 a.a. |
| NCBI ID | WP_014573336.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain Wg2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2216054..2224284 | 2221594..2221782 | within | 0 |
Gene organization within MGE regions
Location: 2216054..2224284
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLWG2_RS11485 (LLWG2_11540) | - | 2217520..2218329 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLWG2_RS11490 (LLWG2_11545) | - | 2218322..2219059 (-) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| LLWG2_RS11495 (LLWG2_11550) | - | 2219238..2220080 (-) | 843 | WP_021164979.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLWG2_RS11500 (LLWG2_11555) | - | 2220077..2220514 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLWG2_RS11505 (LLWG2_11560) | comGG | 2220594..2220821 (-) | 228 | WP_228764408.1 | competence protein ComGG | Machinery gene |
| LLWG2_RS11510 (LLWG2_11565) | comGF | 2220917..2221342 (-) | 426 | WP_014735174.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLWG2_RS11515 (LLWG2_11570) | comGE | 2221326..2221622 (-) | 297 | WP_021164977.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLWG2_RS11520 (LLWG2_11575) | comGD | 2221594..2221782 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| LLWG2_RS11525 (LLWG2_11580) | comGC | 2221984..2222334 (-) | 351 | WP_050574187.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LLWG2_RS11530 (LLWG2_11585) | comGB | 2222379..2223404 (-) | 1026 | WP_050574185.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LLWG2_RS11535 (LLWG2_11590) | comGA | 2223304..2224284 (-) | 981 | WP_021164974.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7336.65 Da Isoelectric Point: 8.3463
>NTDB_id=854835 LLWG2_RS11520 WP_014573336.1 2221594..2221782(-) (comGD) [Lactococcus cremoris strain Wg2]
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
Nucleotide
Download Length: 189 bp
>NTDB_id=854835 LLWG2_RS11520 WP_014573336.1 2221594..2221782(-) (comGD) [Lactococcus cremoris strain Wg2]
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Lactococcus lactis subsp. cremoris KW2 |
93.548 |
100 |
0.935 |
| comYD | Streptococcus mutans UA140 |
43.396 |
85.484 |
0.371 |
| comYD | Streptococcus mutans UA159 |
43.396 |
85.484 |
0.371 |