Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   LLD17_RS12330 Genome accession   NZ_CP129182
Coordinates   2251829..2252056 (-) Length   75 a.a.
NCBI ID   WP_228764408.1    Uniprot ID   -
Organism   Lactococcus cremoris strain D.1.7     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2246041..2255519 2251829..2252056 within 0


Gene organization within MGE regions


Location: 2246041..2255519
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLD17_RS12310 (LLD17_12360) - 2248755..2249564 (-) 810 WP_011677177.1 metal ABC transporter permease -
  LLD17_RS12315 (LLD17_12365) - 2249557..2250294 (-) 738 WP_011677178.1 metal ABC transporter ATP-binding protein -
  LLD17_RS12320 (LLD17_12370) - 2250473..2251315 (-) 843 WP_011677179.1 metal ABC transporter solute-binding protein, Zn/Mn family -
  LLD17_RS12325 (LLD17_12375) - 2251312..2251749 (-) 438 WP_011677180.1 zinc-dependent MarR family transcriptional regulator -
  LLD17_RS12330 (LLD17_12380) comGG 2251829..2252056 (-) 228 WP_228764408.1 competence protein ComGG Machinery gene
  LLD17_RS12335 (LLD17_12385) comGF 2252152..2252577 (-) 426 WP_014735174.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLD17_RS12340 (LLD17_12390) comGE 2252561..2252797 (-) 237 WP_014573335.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLD17_RS12345 (LLD17_12395) comGD 2252829..2253017 (-) 189 WP_014573336.1 hypothetical protein Machinery gene
  LLD17_RS12350 (LLD17_12400) comGC 2253219..2253596 (-) 378 Protein_2265 competence type IV pilus major pilin ComGC -
  LLD17_RS12355 (LLD17_12405) comGB 2253614..2254639 (-) 1026 WP_050574185.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLD17_RS12360 (LLD17_12410) comGA 2254539..2255519 (-) 981 WP_162494683.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence


Protein


Download         Length: 75 a.a.        Molecular weight: 8406.73 Da        Isoelectric Point: 9.0864

>NTDB_id=851410 LLD17_RS12330 WP_228764408.1 2251829..2252056(-) (comGG) [Lactococcus cremoris strain D.1.7]
MKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSNKTYCFDVRLKDGRIYQIVK

Nucleotide


Download         Length: 228 bp        

>NTDB_id=851410 LLD17_RS12330 WP_228764408.1 2251829..2252056(-) (comGG) [Lactococcus cremoris strain D.1.7]
TTGAAAATAGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCA
ACTTAATTTTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTG
TTAGTAATAAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTATCAAATAGTAAAGTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

96

100

0.96