Detailed information
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | LLD17_RS12330 | Genome accession | NZ_CP129182 |
| Coordinates | 2251829..2252056 (-) | Length | 75 a.a. |
| NCBI ID | WP_228764408.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain D.1.7 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2246041..2255519 | 2251829..2252056 | within | 0 |
Gene organization within MGE regions
Location: 2246041..2255519
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLD17_RS12310 (LLD17_12360) | - | 2248755..2249564 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLD17_RS12315 (LLD17_12365) | - | 2249557..2250294 (-) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| LLD17_RS12320 (LLD17_12370) | - | 2250473..2251315 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLD17_RS12325 (LLD17_12375) | - | 2251312..2251749 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLD17_RS12330 (LLD17_12380) | comGG | 2251829..2252056 (-) | 228 | WP_228764408.1 | competence protein ComGG | Machinery gene |
| LLD17_RS12335 (LLD17_12385) | comGF | 2252152..2252577 (-) | 426 | WP_014735174.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLD17_RS12340 (LLD17_12390) | comGE | 2252561..2252797 (-) | 237 | WP_014573335.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLD17_RS12345 (LLD17_12395) | comGD | 2252829..2253017 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| LLD17_RS12350 (LLD17_12400) | comGC | 2253219..2253596 (-) | 378 | Protein_2265 | competence type IV pilus major pilin ComGC | - |
| LLD17_RS12355 (LLD17_12405) | comGB | 2253614..2254639 (-) | 1026 | WP_050574185.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LLD17_RS12360 (LLD17_12410) | comGA | 2254539..2255519 (-) | 981 | WP_162494683.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Sequence
Protein
Download Length: 75 a.a. Molecular weight: 8406.73 Da Isoelectric Point: 9.0864
>NTDB_id=851410 LLD17_RS12330 WP_228764408.1 2251829..2252056(-) (comGG) [Lactococcus cremoris strain D.1.7]
MKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSNKTYCFDVRLKDGRIYQIVK
MKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSNKTYCFDVRLKDGRIYQIVK
Nucleotide
Download Length: 228 bp
>NTDB_id=851410 LLD17_RS12330 WP_228764408.1 2251829..2252056(-) (comGG) [Lactococcus cremoris strain D.1.7]
TTGAAAATAGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCA
ACTTAATTTTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTG
TTAGTAATAAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTATCAAATAGTAAAGTAA
TTGAAAATAGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCA
ACTTAATTTTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTG
TTAGTAATAAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTATCAAATAGTAAAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Lactococcus lactis subsp. cremoris KW2 |
96 |
100 |
0.96 |